Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human ASGR2

Cat.No. : ASGR2-26516TH
Product Overview : Recombinant full length Human Asialoglycoprotein Receptor 2, isoform 3 , with an N terminal proprietary tag; predicted MW 57.31 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : This gene encodes a subunit of the asialoglycoprotein receptor. This receptor is a transmembrane protein that plays a critical role in serum glycoprotein homeostasis by mediating the endocytosis and lysosomal degradation of glycoproteins with exposed terminal galactose or N-acetylgalactosamine residues. The asialoglycoprotein receptor may facilitate hepatic infection by multiple viruses including hepatitis B, and is also a target for liver-specific drug delivery. The asialoglycoprotein receptor is a hetero-oligomeric protein composed of major and minor subunits, which are encoded by different genes. The protein encoded by this gene is the less abundant minor subunit. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Protein length : 287 amino acids
Molecular Weight : 57.310kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Expressed exclusively in hepatic parenchymal cells.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MAKDFQDIQQLSSEENDHPFHQGPPPAQPLAQRLCSMVCF SLLALSFNILLLVVICVTGSQSAQLQAELRSLKEAFSNFS SSTLTEVQAISTHGGSVGDKITSLGAKLEKQQQDLKADHD ALLFHLKHFPVDLRFVACQMELLHSNGSQRTCCPVNWVEH QGSCYWFSHSGKAWAEAEKYCQLENAHLVVINSWEEQRFI VQHTNPFNTWIGLTDSDGSWKWVDGTDYRHNYKNWAVTQP DNWRGHELGGSEDCVEVQPDGRWNDDFCLQVYRWVCEKRR NATGEVA
Sequence Similarities : Contains 1 C-type lectin domain.
Gene Name : ASGR2 asialoglycoprotein receptor 2 [ Homo sapiens ]
Official Symbol : ASGR2
Synonyms : ASGR2; asialoglycoprotein receptor 2; CLEC4H2;
Gene ID : 433
mRNA Refseq : NM_001181
Protein Refseq : NP_001172
MIM : 108361
Uniprot ID : P07307
Chromosome Location : 17p
Function : asialoglycoprotein receptor activity; protein binding; receptor activity; sugar binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All ASGR2 Products

Required fields are marked with *

My Review for All ASGR2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends