Recombinant Human ATP1A4 protein, GST-tagged
Cat.No. : | ATP1A4-301281H |
Product Overview : | Recombinant Human ATP1A4 (1-42 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Source : | E. coli |
Species : | Human |
Tag : | GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Protein length : | Met1-Glu42 |
AA Sequence : | MGLWGKKGTVAPHDQSPRRRPKKGLIKKKMVKREKQKRNMEE |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name : | ATP1A4 ATPase Na+/K+ transporting subunit alpha 4 [ Homo sapiens (human) ] |
Official Symbol : | ATP1A4 |
Synonyms : | ATP1A1; ATP1AL2 |
Gene ID : | 480 |
mRNA Refseq : | NM_001001734 |
Protein Refseq : | NP_001001734 |
MIM : | 607321 |
UniProt ID : | Q13733 |
Products Types
◆ Recombinant Protein | ||
Atp1a4-265R | Recombinant Rat Atp1a4 Protein, His-tagged | +Inquiry |
ATP1A4-849M | Recombinant Mouse ATP1A4 Protein, His (Fc)-Avi-tagged | +Inquiry |
ATP1A4-511R | Recombinant Rat ATP1A4 Protein, His (Fc)-Avi-tagged | +Inquiry |
ATP1A4-964H | Recombinant Human ATP1A4 protein, GST-tagged | +Inquiry |
ATP1A4-3119H | Recombinant Human ATP1A4 protein, His-tagged | +Inquiry |
◆ Lysates | ||
ATP1A4-46HCL | Recombinant Human ATP1A4 lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All ATP1A4 Products
Required fields are marked with *
My Review for All ATP1A4 Products
Required fields are marked with *
0
Inquiry Basket