Recombinant Human AXIN1, His-tagged
Cat.No. : | AXIN1-26564TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 663-826 of Human Axin 1 with N terminal His tag; Predicted MWt 20 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Description : | This gene encodes a cytoplasmic protein which contains a regulation of G-protein signaling (RGS) domain and a dishevelled and axin (DIX) domain. The encoded protein interacts with adenomatosis polyposis coli, catenin beta-1, glycogen synthase kinase 3 beta, protein phosphate 2, and itself. This protein functions as a negative regulator of the wingless-type MMTV integration site family, member 1 (WNT) signaling pathway and can induce apoptosis. The crystal structure of a portion of this protein, alone and in a complex with other proteins, has been resolved. Mutations in this gene have been associated with hepatocellular carcinoma, hepatoblastomas, ovarian endometriod adenocarcinomas, and medullablastomas. Two transcript variants encoding distinct isoforms have been identified for this gene. |
Conjugation : | HIS |
Source : | E. coli |
Tissue specificity : | Ubiquitously expressed. |
Form : | Lyophilised:Reconstitute with 86 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | ENSRPLSLEHPWAGPQLRTSVQPSHLFIQDPTMPPHPAPN PLTQLEEARRRLEEEEKRASRAPSKQRTRSQRKVGGGS AQPCDSIVVAYYFCGEPIPYRTLVRGRAVTLGQFKELL TKKGSYRYYFKKVSDEFDCGVVFEEVREDEAVLPVFEE KIIGKVEKVD |
Sequence Similarities : | Contains 1 DIX domain.Contains 1 RGS domain. |
Gene Name : | AXIN1 axin 1 [ Homo sapiens ] |
Official Symbol : | AXIN1 |
Synonyms : | AXIN1; axin 1; axin-1; PPP1R49; protein phosphatase 1; regulatory subunit 49; |
Gene ID : | 8312 |
mRNA Refseq : | NM_003502 |
Protein Refseq : | NP_003493 |
MIM : | 603816 |
Uniprot ID : | O15169 |
Chromosome Location : | 16p13.3 |
Pathway : | Basal cell carcinoma, organism-specific biosystem; Basal cell carcinoma, conserved biosystem; Beta-catenin phosphorylation cascade, organism-specific biosystem; C-MYC pathway, organism-specific biosystem; Canonical Wnt signaling pathway, organism-specific biosystem; |
Function : | GTPase activator activity; I-SMAD binding; R-SMAD binding; SMAD binding; armadillo repeat domain binding; |
Products Types
◆ Recombinant Protein | ||
AXIN1-388H | Recombinant Human AXIN1 Protein, His-tagged | +Inquiry |
Axin1-390R | Recombinant Rat Axin1 Protein, His-tagged | +Inquiry |
Axin1-684M | Recombinant Mouse Axin1 Protein, MYC/DDK-tagged | +Inquiry |
AXIN1-2524H | Recombinant Human AXIN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Axin1-389M | Recombinant Mouse Axin1 Protein, His-tagged | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All AXIN1 Products
Required fields are marked with *
My Review for All AXIN1 Products
Required fields are marked with *
0
Inquiry Basket