Recombinant Human BAK1
Cat.No. : | BAK1-26168TH |
Product Overview : | Recombinant fragment corresponding to amino acids 100-211 of Human Bak with an N terminal proprietary tag; Predicted MWt 37.95 kDa. |
- Specification
- Gene Information
- Related Products
Description : | The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form oligomers or heterodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein localizes to mitochondria, and functions to induce apoptosis. It interacts with and accelerates the opening of the mitochondrial voltage-dependent anion channel, which leads to a loss in membrane potential and the release of cytochrome c. This protein also interacts with the tumor suppressor P53 after exposure to cell stress. |
Protein length : | 112 amino acids |
Molecular Weight : | 37.950kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Expressed in a wide variety of tissues, with highest levels in the heart and skeletal muscle. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | LQPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLA LHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVA ALNLGNGPILNVLVVLGVVLLGQFVVRRFFKS |
Sequence Similarities : | Belongs to the Bcl-2 family. |
Gene Name : | BAK1 BCL2-antagonist/killer 1 [ Homo sapiens ] |
Official Symbol : | BAK1 |
Synonyms : | BAK1; BCL2-antagonist/killer 1; CDN1; bcl-2 homologous antagonist/killer; BAK; BCL2L7; |
Gene ID : | 578 |
mRNA Refseq : | NM_001188 |
Protein Refseq : | NP_001179 |
MIM : | 600516 |
Uniprot ID : | Q16611 |
Chromosome Location : | 6p21.31 |
Pathway : | Activation and oligomerization of BAK protein, organism-specific biosystem; Apoptosis, organism-specific biosystem; Apoptosis, organism-specific biosystem; Direct p53 effectors, organism-specific biosystem; Intrinsic Pathway for Apoptosis, organism-specific biosystem; |
Function : | BH domain binding; chaperone binding; heat shock protein binding; identical protein binding; metal ion binding; |
Products Types
◆ Recombinant Protein | ||
BAK1-337R | Recombinant Rhesus Macaque BAK1 Protein, His (Fc)-Avi-tagged | +Inquiry |
BAK1-35H | Recombinant Human BAK1 Protein, His-tagged | +Inquiry |
BAK1-2609C | Recombinant Chicken BAK1 | +Inquiry |
BAK1-26166TH | Recombinant Human BAK1 Protein, GST-tagged | +Inquiry |
BAK1-509R | Recombinant Rhesus monkey BAK1 Protein, His-tagged | +Inquiry |
◆ Lysates | ||
BAK1-8519HCL | Recombinant Human BAK1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket