Recombinant Human BCS1L, His-tagged
Cat.No. : | BCS1L-26667TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 236-418 of Human BCS1L with N terminal His tag; 183 amino acids, 21kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a homolog of the S. cerevisiae bcs1 protein which is involved in the assembly of complex III of the mitochondrial respiratory chain. The encoded protein does not contain a mitochondrial targeting sequence but experimental studies confirm that it is imported into mitochondria. Mutations in this gene are associated with mitochondrial complex III deficiency and the GRACILE syndrome. Two alternatively spliced transcripts encoding the same protein have been described. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 71 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | KSSFITALAGELEHSICLLSLTDSSLSDDRLNHLLSVAPQ QSLVLLEDVDAAFLSRDLAVENPVKYQGLGRLTFSGLL NALDGVASTEARIVFMTTNHVDRLDPALIRPGRVDLKEYV GYCSHWQLTQMFQRFYPGQAPSLAENFAEHVLRATNQI SPAQVQGYFMLYKNDPVGAIHNAESLR |
Gene Name : | BCS1L BCS1-like (S. cerevisiae) [ Homo sapiens ] |
Official Symbol : | BCS1L |
Synonyms : | BCS1L; BCS1-like (S. cerevisiae); BCS1 (yeast homolog) like , BCS1 like (yeast); mitochondrial chaperone BCS1; BCS; Bjornstad syndrome; BJS; GRACILE syndrome; h BCS; Hs.6719; |
Gene ID : | 617 |
mRNA Refseq : | NM_001079866 |
Protein Refseq : | NP_001073335 |
MIM : | 603647 |
Uniprot ID : | Q9Y276 |
Chromosome Location : | 2q35 |
Function : | ATP binding; nucleoside-triphosphatase activity; nucleotide binding; protein binding; |
Products Types
◆ Recombinant Protein | ||
BCS1L-1006M | Recombinant Mouse BCS1L Protein, His (Fc)-Avi-tagged | +Inquiry |
BCS1L-2464H | Recombinant Human BCS1L Protein, MYC/DDK-tagged | +Inquiry |
BCS1L-356R | Recombinant Rhesus Macaque BCS1L Protein, His (Fc)-Avi-tagged | +Inquiry |
Bcs1l-1853M | Recombinant Mouse Bcs1l Protein, Myc/DDK-tagged | +Inquiry |
BCS1L-1658C | Recombinant Chicken BCS1L | +Inquiry |
◆ Lysates | ||
BCS1L-167HCL | Recombinant Human BCS1L cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket