Recombinant Human BOK
Cat.No. : | BOK-27663TH |
Product Overview : | Recombinant full length Human Bok with N terminal proprietary tag; Predicted MW 50.30 kDa. |
- Specification
- Gene Information
- Related Products
Description : | The protein encoded by this gene belongs to the BCL2 family, members of which form homo- or heterodimers, and act as anti- or proapoptotic regulators that are involved in a wide variety of cellular processes. Studies in rat show that this protein has restricted expression in reproductive tissues, interacts strongly with some antiapoptotic BCL2 proteins, not at all with proapoptotic BCL2 proteins, and induces apoptosis in transfected cells. Thus, this protein represents a proapoptotic member of the BCL2 family. |
Protein length : | 212 amino acids |
Molecular Weight : | 50.300kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Expressed in brain, liver, appendix and lymphoid tissues. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MEVLRRSSVFAAEIMDAFDRSPTDKELVAQAKALGREYVH ARLLRAGLSWSAPERAAPVPGRLAEVCAVLLRLGDELEMI RPSVYRNVARQLHISLQSEPVVTDAFLAVAGHIFSAGITW GKVVSLYAVAAGLAVDCVRQAQPAMVHALVDCLGEFVRKT LATWLRRRGGWTDVLKCVVSTDPGLRSHWLVAALCSFGRF LKAAFFVLLPER |
Sequence Similarities : | Belongs to the Bcl-2 family. |
Gene Name : | BOK BCL2-related ovarian killer [ Homo sapiens ] |
Official Symbol : | BOK |
Synonyms : | BOK; BCL2-related ovarian killer; bcl-2-related ovarian killer protein; BCL2L9; BOKL; MGC4631; |
Gene ID : | 666 |
mRNA Refseq : | NM_032515 |
Protein Refseq : | NP_115904 |
MIM : | 605404 |
Uniprot ID : | Q9UMX3 |
Chromosome Location : | 2q37.3 |
Pathway : | Apoptosis, organism-specific biosystem; TP53 network, organism-specific biosystem; |
Function : | BH domain binding; protein binding; protein heterodimerization activity; |
Products Types
◆ Recombinant Protein | ||
BOK-660R | Recombinant Rat BOK Protein, His (Fc)-Avi-tagged | +Inquiry |
BOK-379R | Recombinant Rhesus Macaque BOK Protein, His (Fc)-Avi-tagged | +Inquiry |
BOK-1065M | Recombinant Mouse BOK Protein, His (Fc)-Avi-tagged | +Inquiry |
BOK-1002R | Recombinant Rat BOK Protein | +Inquiry |
BOK-6271C | Recombinant Chicken BOK | +Inquiry |
◆ Lysates | ||
BOK-8420HCL | Recombinant Human BOK 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket