Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human CACYBP, His-tagged

Cat.No. : CACYBP-29815TH
Product Overview : Recombinant full length protein, corresponding to amino acids 1-228 of Human SIAH Interacting Protein with an N terminal His tag. Predicted MWt: 27 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : The protein encoded by this gene is a calcyclin binding protein. It may be involved in calcium-dependent ubiquitination and subsequent proteosomal degradation of target proteins. It probably serves as a molecular bridge in ubiquitin E3 complexes and participates in the ubiquitin-mediated degradation of beta-catenin. Two alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Conjugation : HIS
Source : E. coli
Form : Lyophilised:Reconstitute with 100 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MASEELQKDLEEVKVLLEKATRKRVRDALTAEKSKIETEI KNKMQQKSQKKAELLDNEKPAAVVAPITTGYTVKISNY GWDQSDKFVKIYITLTGVHQVPTENVQVHFTERSFDLL VKNLNGKSYSMIVNNLLKPISVEGSSKKVKTDTVLILC RKKVENTRWDYLTQVEKECKEKEKPSYDTETDPSEGLMNV LKKIYEDGDDDMKRTINKAWVESREKQAKGDTEF
Gene Name : CACYBP calcyclin binding protein [ Homo sapiens ]
Official Symbol : CACYBP
Synonyms : CACYBP; calcyclin binding protein; calcyclin-binding protein; S100A6BP; SIP;
Gene ID : 27101
mRNA Refseq : NM_001007214
Protein Refseq : NP_001007215
MIM : 606186
Uniprot ID : Q9HB71
Chromosome Location : 1q24-q25
Pathway : Wnt signaling pathway, organism-specific biosystem; Wnt signaling pathway, conserved biosystem;
Function : protein binding; protein homodimerization activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (5)

Ask a question
How does the phosphorylation of CACYBP influence its biochemical properties and cellular functions? 01/17/2022

Phosphorylation of CACYBP can modulate its protein-protein interactions and stability. Phosphorylation events may affect its role in cell cycle regulation and ubiquitin-dependent protein degradation.

How does CACYBP's calcium-binding capability influence its conformational dynamics and interactions with calcium-dependent proteins? 07/30/2020

CACYBP's calcium-binding domains undergo conformational changes upon calcium binding, which can affect its interactions with other proteins. It allows CACYBP to act as a calcium-dependent scaffold for various signaling complexes.

What are the biochemical mechanisms underlying the influence of CACYBP on cell cycle progression, including its interactions with Cyclins and CDKs? 11/25/2019

CACYBP interacts with Cyclins and CDKs, forming complexes that regulate the phosphorylation of key cell cycle regulators. These interactions affect the progression through different phases of the cell cycle.

Can you explain the role of CACYBP in ubiquitin-dependent protein degradation and its connection to the proteasome system? 04/09/2019

CACYBP functions as an adaptor protein in ubiquitin-dependent protein degradation by facilitating the transfer of ubiquitin moieties to target proteins. It forms complexes with E3 ubiquitin ligases and substrates, directing them to the proteasome for degradation.

Can you discuss the role of CACYBP in cellular responses to stress, including oxidative stress and DNA damage, and its molecular mechanisms in these contexts? 12/08/2018

CACYBP participates in stress responses by modulating the stability and activity of proteins involved in stress pathways. For example, it can influence the stability of DNA repair proteins and oxidative stress response factors, contributing to cellular adaptation to stress conditions.

Customer Reviews (3)

Write a review
Reviews
11/15/2021

    I saw results within weeks.

    04/19/2020

      Impressed with the results.

      07/06/2018

        High-quality product.

        Ask a Question for All CACYBP Products

        Required fields are marked with *

        My Review for All CACYBP Products

        Required fields are marked with *

        0

        Inquiry Basket

        cartIcon
        logo

        FOLLOW US

        Terms and Conditions        Privacy Policy

        Copyright © 2024 Creative BioMart. All Rights Reserved.

        Contact Us

        • /

        Stay Updated on the Latest Bioscience Trends