Recombinant Human CAPZB, His-tagged
Cat.No. : | CAPZB-26238TH |
Product Overview : | Recombinant full length protein, corresponding to amino acids 1-272 of Human CAPZB with N terminal His tag, 34kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes the beta subunit of the barbed-end actin binding protein, which belongs to the F-actin capping protein family. The capping protein is a heterodimeric actin capping protein that blocks actin filament assembly and disassembly at the fast growing (barbed) filament ends and functions in regulating actin filament dynamics as well as in stabilizing actin filament lengths in muscle and nonmuscle cells. Multiple alternatively spliced transcript variants encoding different isoforms have been found. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:For lot 903131, please reconstitute with 148 μl aqua dest.For lot 935335 and above, please reconstitute with 155 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MSDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLL SSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNK YDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSS VYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEV QEKSSGRTAHYKLTSTVMLWLQTNKSGSGTMNLGGSLT RQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFG KTKDIVNGLRSVQTFADKSKQEALKNDLVEALKRKQQC |
Sequence Similarities : | Belongs to the F-actin-capping protein beta subunit family. |
Gene Name : | CAPZB capping protein (actin filament) muscle Z-line, beta [ Homo sapiens ] |
Official Symbol : | CAPZB |
Synonyms : | CAPZB; capping protein (actin filament) muscle Z-line, beta; F-actin-capping protein subunit beta; |
Gene ID : | 832 |
mRNA Refseq : | NM_001206540 |
Protein Refseq : | NP_001193469 |
MIM : | 601572 |
Uniprot ID : | P47756 |
Chromosome Location : | 1p36.1 |
Pathway : | Factors involved in megakaryocyte development and platelet production, organism-specific biosystem; Hemostasis, organism-specific biosystem; |
Function : | actin binding; |
Products Types
◆ Recombinant Protein | ||
CAPZB-0388H | Recombinant Human CAPZB Protein, GST-Tagged | +Inquiry |
CAPZB-2484H | Recombinant Human CAPZB Protein, MYC/DDK-tagged | +Inquiry |
CAPZB-794R | Recombinant Rat CAPZB Protein, His (Fc)-Avi-tagged | +Inquiry |
CAPZB-4072C | Recombinant Chicken CAPZB | +Inquiry |
CAPZB-2633H | Recombinant Human CAPZB protein, GST-tagged | +Inquiry |
◆ Lysates | ||
CAPZB-281HCL | Recombinant Human CAPZB cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket