Recombinant Human CARHSP1, His-tagged
Cat.No. : | CARHSP1-26810TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 26-147 of Human CARHSP1 with N terminal His tag; Predicted MWt 14 kDa. |
- Specification
- Gene Information
- Related Products
Description : | CARHSP1 is a serine phosphoprotein originally identified as a physiological substrate for the Ca2+-calmodulin regulated protein phosphatase calcineurin (PP2B). |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 73 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | SRERSPSPLRGNVVPSPLPTRRTRTFSATVRASQGPVYKG VCKCFCRSKGHGFITPADGGPDIFLHISDVEGEYVPVE GDEVTYKMCSIPPKNEKLQAVEVVITHLAPGTKHETWS GHVISS |
Sequence Similarities : | Contains 1 CSD (cold-shock) domain. |
Gene Name : | CARHSP1 calcium regulated heat stable protein 1, 24kDa [ Homo sapiens ] |
Official Symbol : | CARHSP1 |
Synonyms : | CARHSP1; calcium regulated heat stable protein 1, 24kDa; calcium regulated heat stable protein 1 (24kD); calcium-regulated heat stable protein 1; CRHSP 24; CSDC1; |
Gene ID : | 23589 |
mRNA Refseq : | NM_001042476 |
Protein Refseq : | NP_001035941 |
Uniprot ID : | Q9Y2V2 |
Chromosome Location : | 16p13.2 |
Function : | DNA binding; RNA binding; mRNA 3-UTR binding; phosphatase binding; |
Products Types
◆ Recombinant Protein | ||
CARHSP1-454H | Recombinant Human CARHSP1 protein(Met1-Ser147), His-tagged | +Inquiry |
Carhsp1-1965M | Recombinant Mouse Carhsp1 Protein, Myc/DDK-tagged | +Inquiry |
CARHSP1-0401H | Recombinant Human CARHSP1 Protein, GST-Tagged | +Inquiry |
CARHSP1-796R | Recombinant Rat CARHSP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CARHSP1-456R | Recombinant Rhesus Macaque CARHSP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Lysates | ||
CARHSP1-7847HCL | Recombinant Human CARHSP1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket