Recombinant Human CAV2
Cat.No. : | CAV2-26609TH |
Product Overview : | Recombinant full length Human Caveolin 2 (amino acids 1-162) with a N terminal proprietary tag: predicted molecular weight 43.89 kDa. |
- Specification
- Gene Information
- Related Products
Description : | The protein encoded by this gene is a major component of the inner surface of caveolae, small invaginations of the plasma membrane, and is involved in essential cellular functions, including signal transduction, lipid metabolism, cellular growth control and apoptosis. This protein may function as a tumor suppressor. This gene and related family member (CAV1) are located next to each other on chromosome 7, and express colocalizing proteins that form a stable hetero-oligomeric complex. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. Additional isoforms resulting from the use of alternate in-frame translation initiation codons have also been described, and shown to have preferential localization in the cell (PMID:11238462). |
Protein length : | 162 amino acids |
Molecular Weight : | 43.890kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Expressed in endothelial cells, smooth muscle cells, skeletal myoblasts and fibroblasts. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MGLETEKADVQLFMDDDSYSHHSGLEYADPEKFADSDQDR DPHRLNSHLKLGFEDVIAEPVTTHSFDKVWICSHALFEIS KYVMYKFLTVFLAIPLAFIAGILFATLSCLHIWILMPFVK TCLMVLPSVQTIWKSVTDVIIAPLCTSVGRCFSSVSLQLS QD |
Sequence Similarities : | Belongs to the caveolin family. |
Gene Name : | CAV2 caveolin 2 [ Homo sapiens ] |
Official Symbol : | CAV2 |
Synonyms : | CAV2; caveolin 2; caveolin-2; CAV; |
Gene ID : | 858 |
mRNA Refseq : | NM_001206747 |
Protein Refseq : | NP_001193676 |
MIM : | 601048 |
Uniprot ID : | P51636 |
Chromosome Location : | 7q31 |
Pathway : | Bacterial invasion of epithelial cells, organism-specific biosystem; Bacterial invasion of epithelial cells, conserved biosystem; EGFR1 Signaling Pathway, organism-specific biosystem; Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; |
Function : | D1 dopamine receptor binding; phosphoprotein binding; protein binding; protein homodimerization activity; syntaxin binding; |
Products Types
◆ Recombinant Protein | ||
CAV2-2598H | Recombinant Human CAV2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Cav2-781M | Recombinant Mouse Cav2 Protein, MYC/DDK-tagged | +Inquiry |
CAV2-0448H | Recombinant Human CAV2 Protein, GST-Tagged | +Inquiry |
CAV2-463R | Recombinant Rhesus Macaque CAV2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CAV2-811R | Recombinant Rat CAV2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Lysates | ||
CAV2-7820HCL | Recombinant Human CAV2 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket