Recombinant Human CBR1
Cat.No. : | CBR1-26327TH |
Product Overview : | Recombinant full length Human CBR1 , 30kDa. |
- Specification
- Gene Information
- Related Products
Description : | Carbonyl reductase is one of several monomeric, NADPH-dependent oxidoreductases having wide specificity for carbonyl compounds. This enzyme is widely distributed in human tissues. Another carbonyl reductase gene, CRB3, lies close to this gene on chromosome 21q. |
Protein length : | 277 amino acids |
Molecular Weight : | 30.000kDa |
Source : | E. coli |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | pH: 8.50Constituents:0.32% Tris HCl, 10% Glycerol |
Storage : | Please see Notes section |
Sequences of amino acids : | MSSGIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDV TRGQAAVQQLQAEGLSPRFHQLDIDDLQSIRALRDFLRKE YGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRD VCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRS ETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIG VTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKA TKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW |
Sequence Similarities : | Belongs to the short-chain dehydrogenases/reductases (SDR) family. |
Gene Name : | CBR1 carbonyl reductase 1 [ Homo sapiens ] |
Official Symbol : | CBR1 |
Synonyms : | CBR1; carbonyl reductase 1; CBR; carbonyl reductase [NADPH] 1; SDR21C1; short chain dehydrogenase/reductase family 21C; member 1; |
Gene ID : | 873 |
mRNA Refseq : | NM_001757 |
Protein Refseq : | NP_001748 |
MIM : | 114830 |
Uniprot ID : | P16152 |
Chromosome Location : | 21q22.1 |
Pathway : | Arachidonic acid metabolism, organism-specific biosystem; Arachidonic acid metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem; Metabolism of xenobiotics by cytochrome P450, organism-specific biosystem; Metabolism of xenobiotics by cytochrome P450, conserved biosystem; |
Function : | 15-hydroxyprostaglandin dehydrogenase (NADP+) activity; carbonyl reductase (NADPH) activity; nucleotide binding; oxidoreductase activity; prostaglandin-E2 9-reductase activity; |
Products Types
◆ Recombinant Protein | ||
Cbr1-791M | Recombinant Mouse Cbr1 Protein, MYC/DDK-tagged | +Inquiry |
Cbr1-593R | Recombinant Rat Cbr1 Protein, His-tagged | +Inquiry |
CBR1-0467H | Recombinant Human CBR1 Protein, GST-Tagged | +Inquiry |
Cbr1-592M | Recombinant Mouse Cbr1 Protein, His-tagged | +Inquiry |
CBR1-817R | Recombinant Rat CBR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Lysates | ||
CBR1-288HCL | Recombinant Human CBR1 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket