Recombinant Human CBX3
Cat.No. : | CBX3-27362TH |
Product Overview : | Recombinant full length Human HP1 gamma protein, expressed in Saccharomyces cerevisiae. 183 amino acids, MW 20.7 kDa, |
- Specification
- Gene Information
- Related Products
Description : | At the nuclear envelope, the nuclear lamina and heterochromatin are adjacent to the inner nuclear membrane. The protein encoded by this gene binds DNA and is a component of heterochromatin. This protein also can bind lamin B receptor, an integral membrane protein found in the inner nuclear membrane. The dual binding functions of the encoded protein may explain the association of heterochromatin with the inner nuclear membrane. This protein binds histone H3 tails methylated at Lys-9 sites. This protein is also recruited to sites of ultraviolet-induced DNA damage and double-strand breaks. Two transcript variants encoding the same protein but differing in the 5 UTR, have been found for this gene. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MASNKTTLQKMGKKQNGKSKKVEEAEPEEFVVEKVLDRRV VNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLN SQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADKPRG FARGLDPERIIGATDSSGELMFLMKWKDSDEADLVLAK EANMKCPQIVIAFYEERLTWHSCPEDEAQ |
Sequence Similarities : | Contains 2 chromo domains. |
Gene Name : | CBX3 chromobox homolog 3 [ Homo sapiens ] |
Official Symbol : | CBX3 |
Synonyms : | CBX3; chromobox homolog 3; chromobox homolog 3 (Drosophila HP1 gamma); chromobox protein homolog 3; HP1 gamma homolog (Drosophila); HP1Hs gamma; |
Gene ID : | 11335 |
mRNA Refseq : | NM_007276 |
Protein Refseq : | NP_009207 |
MIM : | 604477 |
Uniprot ID : | Q13185 |
Chromosome Location : | 7p15.2 |
Pathway : | Diurnally regulated genes with circadian orthologs, organism-specific biosystem; RNA Polymerase I Chain Elongation, organism-specific biosystem; RNA Polymerase I Transcription, organism-specific biosystem; RNA Polymerase I, RNA Polymerase III, and Mitochondrial Transcription, organism-specific biosystem; Transcription, organism-specific biosystem; |
Function : | enzyme binding; identical protein binding; protein binding; protein domain specific binding; |
Products Types
◆ Recombinant Protein | ||
CBX3-475R | Recombinant Rhesus Macaque CBX3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Cbx3-595M | Recombinant Mouse Cbx3 Protein, His-tagged | +Inquiry |
Cbx3-793M | Recombinant Mouse Cbx3 Protein, MYC/DDK-tagged | +Inquiry |
CBX3-0844H | Recombinant Human CBX3 Protein (Met1-Gln183), N-His tagged | +Inquiry |
CBX3-269H | Recombinant Human CBX3 protein, His-tagged | +Inquiry |
◆ Lysates | ||
CBX3-7805HCL | Recombinant Human CBX3 293 Cell Lysate | +Inquiry |
CBX3-7804HCL | Recombinant Human CBX3 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket