Recombinant Human CCL5 Protein

• Cat.No.: CCL5-43H
• Product Overview: Recombinant Human CCL5 Protein was expressed in E. coli.

Specification

• Description: Human CCL5, also known as Regulated upon Activation, Normal T cell Expressed and presumably Secreted (RANTES), attracts and activates leukocytes and plays a primary role in the inflammatory immune response. CCL5 activates several G protein-coupled receptors including CCRs 1, 3, 4, and 5. CCL5 binding to CCR5 inhibits the infectivity of M-tropic HIV-1 strains. Proteolytic removal of the two N-terminal residues by CD26 generates a CCL5 variant that functions as a more potent HIV-1 inhibitor and a CCR5 antagonist.
• Source: E. coli
• Species: Human
• Form: Lyophilized
• Molecular Mass: 7.84701 kDa
• Protein length: 67 amino acid
• AA Sequence: SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQ VCANPEKKWVREYINSLEMS
• Endotoxin: Endotoxin-free <0.01 EU/ug
• Purity: Purity assessed by HPLC, Mass Spectrometry, and NMR
• Storage: Store at -20 to -80 centigrade for 12 months; Store at 4 centigrade for 6 months; Store at RT for 1 month.
• tmpcolum67: C-C motif chemokine ligand 5

Gene Information

• Gene Name: CCL5 C-C motif chemokine ligand 5 [ Homo sapiens (human) ]
• Official Symbol: CCL5
• Synonyms: SISd; eoCP; SCYA5; RANTES; TCP228; D17S136E; SIS-delta
• Gene ID: 6352
• mRNA Refseq: NM_002985
• Protein Refseq: NP_002976
• MIM: 187011
• UniProt ID: P13501