Recombinant Human CCNG1, His-tagged

• Cat.No.: CCNG1-26094TH
• Product Overview: Recombinant full length Human Cyclin G with an N-terminal His tag. 315 amino acides with a predicted MWt34 kDa including the tag

Specification

• Description: The eukaryotic cell cycle is governed by cyclin-dependent protein kinases (CDKs) whose activities are regulated by cyclins and CDK inhibitors. The protein encoded by this gene is a member of the cyclin family and contains the cyclin box. The encoded protein lacks the protein destabilizing (PEST) sequence that is present in other family members. Transcriptional activation of this gene can be induced by tumor protein p53. Two transcript variants encoding the same protein have been identified for this gene.
• Protein length: 295 amino acids
• Conjugation: HIS
• Molecular Weight: 36.200kDa inclusive of tags
• Source: E. coli
• Tissue specificity: High levels in skeletal muscle, ovary, kidney and colon.
• Form: Liquid
• Purity: by SDS-PAGE
• Storage buffer: pH: 8.00Constituents:1.17% Sodium chloride, 0.08% DTT, 50% Glycerol, 0.32% Tris HCl
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMIEVLTTTDSQKLLHQLNAL LEQESRCQPKVCGLRLIESAHDNGLRMTARLRDFEVKDLL SLTQFFGFDTETFSLAVNLLDRFLSKMKVQPKHLGCVGLS CFYLAVKSIEEERNVPLATDLIRISQYRFTVSDLMRMEKI VLEKVCWKVKATTAFQFLQLYYSLLQENLPLERRNSINFE RLEAQLKACHCRIIFSKAKPSVLALSIIALEIQAQKCVEL TEGIECLQKHSKINGRDLTFWQELVSKCLTEYSSNKCSKP NVQKLKWIVSGRTARQLKHSYYRITHLPTIPEMVP
• Sequence Similarities: Belongs to the cyclin family. Cyclin G subfamily.

Gene Information

• Gene Name: CCNG1 cyclin G1 [ Homo sapiens ]
• Official Symbol: CCNG1
• Synonyms: CCNG1; cyclin G1; CCNG; cyclin-G1
• Gene ID: 900
• mRNA Refseq: NM_004060
• Protein Refseq: NP_004051
• MIM: 601578
• Uniprot ID: P51959
• Chromosome Location: 5q32-q34
• Pathway: Direct p53 effectors, organism-specific biosystem; p53 pathway, organism-specific biosystem; p53 signaling pathway, organism-specific biosystem; p53 signaling pathway, conserved biosystem
• Function: protein domain specific binding

Reviews

12/10/2022

Consistently delivers, boosts research productivity.

10/22/2020

Integral to our research, dependable analysis.

08/26/2018

Streamlines our experiments, saving time and effort.

Q&As

What potential does CCNG1 have as a therapeutic target in cancer treatment?

Targeting CCNG1 in cancer therapy could help control tumor growth by affecting cell cycle dynamics.

What is the impact of CCNG1 dysregulation in the progression of various cancers?

Dysregulated CCNG1 expression is linked with the advancement of various cancers due to its role in cell cycle control.

What is the primary function of CCNG1 in cell cycle regulation?

CCNG1, as a cyclin, regulates the cell cycle, particularly the transition between phases.

How does CCNG1 influence cellular senescence and aging?

It contributes to cellular senescence by influencing cell cycle arrest mechanisms.

How do genetic alterations in CCNG1 affect its role in cell cycle regulation and cancer development?

Mutations in CCNG1 can lead to aberrant cell cycle progression, potentially resulting in cancer.

How does CCNG1 interact with other cell cycle regulators and signaling pathways?

CCNG1 works in tandem with other cell cycle proteins and signaling pathways to regulate cell division.

What role does CCNG1 play in DNA damage response and repair mechanisms?

CCNG1 plays a role in DNA damage response, helping to maintain genomic stability.