Recombinant Human CCNG1, His-tagged
Cat.No. : | CCNG1-26094TH |
Product Overview : | Recombinant full length Human Cyclin G with an N-terminal His tag. 315 amino acides with a predicted MWt34 kDa including the tag |
- Specification
- Gene Information
- Related Products
- Download
Description : | The eukaryotic cell cycle is governed by cyclin-dependent protein kinases (CDKs) whose activities are regulated by cyclins and CDK inhibitors. The protein encoded by this gene is a member of the cyclin family and contains the cyclin box. The encoded protein lacks the protein destabilizing (PEST) sequence that is present in other family members. Transcriptional activation of this gene can be induced by tumor protein p53. Two transcript variants encoding the same protein have been identified for this gene. |
Protein length : | 295 amino acids |
Conjugation : | HIS |
Molecular Weight : | 36.200kDa inclusive of tags |
Source : | E. coli |
Tissue specificity : | High levels in skeletal muscle, ovary, kidney and colon. |
Form : | Liquid |
Purity : | by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:1.17% Sodium chloride, 0.08% DTT, 50% Glycerol, 0.32% Tris HCl |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMIEVLTTTDSQKLLHQLNAL LEQESRCQPKVCGLRLIESAHDNGLRMTARLRDFEVKDLL SLTQFFGFDTETFSLAVNLLDRFLSKMKVQPKHLGCVGLS CFYLAVKSIEEERNVPLATDLIRISQYRFTVSDLMRMEKI VLEKVCWKVKATTAFQFLQLYYSLLQENLPLERRNSINFE RLEAQLKACHCRIIFSKAKPSVLALSIIALEIQAQKCVEL TEGIECLQKHSKINGRDLTFWQELVSKCLTEYSSNKCSKP NVQKLKWIVSGRTARQLKHSYYRITHLPTIPEMVP |
Sequence Similarities : | Belongs to the cyclin family. Cyclin G subfamily. |
Gene Name : | CCNG1 cyclin G1 [ Homo sapiens ] |
Official Symbol : | CCNG1 |
Synonyms : | CCNG1; cyclin G1; CCNG; cyclin-G1; |
Gene ID : | 900 |
mRNA Refseq : | NM_004060 |
Protein Refseq : | NP_004051 |
MIM : | 601578 |
Uniprot ID : | P51959 |
Chromosome Location : | 5q32-q34 |
Pathway : | Direct p53 effectors, organism-specific biosystem; p53 pathway, organism-specific biosystem; p53 signaling pathway, organism-specific biosystem; p53 signaling pathway, conserved biosystem; |
Function : | protein domain specific binding; |
Products Types
◆ Recombinant Protein | ||
CCNG1-1408M | Recombinant Mouse CCNG1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCNG1-882R | Recombinant Rat CCNG1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCNG1-0669H | Recombinant Human CCNG1 Protein, GST-Tagged | +Inquiry |
CCNG1-1224R | Recombinant Rat CCNG1 Protein | +Inquiry |
CCNG1-824H | Recombinant Human CCNG1 Protein, DDK-tagged | +Inquiry |
◆ Lysates | ||
CCNG1-7707HCL | Recombinant Human CCNG1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (7)
Ask a questionTargeting CCNG1 in cancer therapy could help control tumor growth by affecting cell cycle dynamics.
Dysregulated CCNG1 expression is linked with the advancement of various cancers due to its role in cell cycle control.
CCNG1, as a cyclin, regulates the cell cycle, particularly the transition between phases.
It contributes to cellular senescence by influencing cell cycle arrest mechanisms.
Mutations in CCNG1 can lead to aberrant cell cycle progression, potentially resulting in cancer.
CCNG1 works in tandem with other cell cycle proteins and signaling pathways to regulate cell division.
CCNG1 plays a role in DNA damage response, helping to maintain genomic stability.
Customer Reviews (3)
Write a reviewConsistently delivers, boosts research productivity.
Integral to our research, dependable analysis.
Streamlines our experiments, saving time and effort.
Ask a Question for All CCNG1 Products
Required fields are marked with *
My Review for All CCNG1 Products
Required fields are marked with *
Inquiry Basket