Recombinant Human chemokine (C-X-C motif) ligand 2, His-tagged
Cat.No. : | CXCL2-224H |
Product Overview : | GRO-Beta Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide ch- ain containing 94 amino acids and having a molecular mass of 10.1 kDa. The GRO-b is fused to 20 amino acid His Tag at N-terminus and purified by proprietary chromatographic techniques. |
- Specification
- Gene Information
- Related Products
Cat. No. : | CXCL2-224H |
Description : | Chemokine (C-X-C motif) ligand 2 (CXCL2) is a small cytokine belonging to the CXC chemokine family that is also called macrophage inflammatory protein 2-alpha (MIP2-alpha), Growth-regulated protein beta (Gro-beta) and Gro oncogene-2 (Gro-2). CXCL2 is 90% identical in amino acid sequence as a related chemokine, CXCL1. This chemokine is secreted by monocytes and macrophages and is chemotactic for polymorphonuclear leukocytes and hematopoietic stem cells. The gene for CXCL2 is located on human chromosome 4 in a cluster of other CXC chemokines. CXCL2 mobilizes cells by interacting with a cell surface chemokine receptor called CXCR2. |
Source : | Human |
Host : | Escherichia Coli. |
Form : | The Human CXCL2 protein solution contains 20mM Tris HCl. |
Purity : | Greater than 95.0% as determined by SDS-PAGE. |
Physical Appearance : | Sterile filtered colorless solution. |
Amino acid sequence : | MGSSHHHHHHSSGLVPRGSHMAPLATELRCQCLQTLQGILKNIQSVK VKSPGPHCAQTVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN |
Storage : | Lyophilized Bone Morphogenetic Protein-2 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution BMP2 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles. |
Gene Name : | CXCL2 chemokine (C-X-C motif) ligand 2 [ Homo sapiens ] |
Official Symbol : | CXCL2 |
Synonyms : | CXCL2; GRO2; GROb; MIP2; MIP2A; SCYB2; MGSA-b; MIP-2a; CINC-2a; MIP2-alpha; MIP-2a; Gro-beta; C-X-C motif chemokine 2; GRO2 oncogene; Growth-regulated protein beta; MGSA beta; chemokine (C-X-C motif) ligand 2; melanoma growth stimulatory activity beta; MIP2A_HUMAN; Macrophage inflammatory protein 2-alpha [Precursor]; Gro-beta |
Gene ID : | 2920 |
mRNA Refseq : | NM_002089 |
Protein Refseq : | NP_002080 |
MIM : | 139110 |
UniProt ID : | P19875 |
Chromosome Location : | 4q21 |
Pathway : | Cytokine-cytokine receptor interaction |
Function : | chemokine activity |
Products Types
◆ Recombinant Protein | ||
Cxcl2-386C | Active Recombinant Rat Cxcl2 Protein (73 aa) | +Inquiry |
CXCL2-64H | Recombinant Human CXCL2 Protein | +Inquiry |
CXCL2-2097M | Recombinant Mouse CXCL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Cxcl2-78M | Active Recombinant Mouse Cxcl2 Protein (Ala28-Asn110), N-His tagged, Animal-free, Carrier-free | +Inquiry |
CXCL2-2165P | Recombinant CXCL2 Protein, His-Flag-StrepII-tagged | +Inquiry |
◆ Lysates | ||
CXCL2-7168HCL | Recombinant Human CXCL2 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket