Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human CHRNA7

Cat.No. : CHRNA7-30390TH
Product Overview : Recombinant Human full length Nicotinic Acetylcholine Receptor alpha 7 protein with a proprietary N-terminal tag; molecular weight 61.05 kDa inclusive of tag
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : The nicotinic acetylcholine receptors (nAChRs) are members of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. The nAChRs are thought to be hetero-pentamers composed of homologous subunits. The proposed structure for each subunit is a conserved N-terminal extracellular domain followed by three conserved transmembrane domains, a variable cytoplasmic loop, a fourth conserved transmembrane domain, and a short C-terminal extracellular region. The protein encoded by this gene forms a homo-oligomeric channel, displays marked permeability to calcium ions and is a major component of brain nicotinic receptors that are blocked by, and highly sensitive to, alpha-bungarotoxin. Once this receptor binds acetylcholine, it undergoes an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. This gene is located in a region identified as a major susceptibility locus for juvenile myoclonic epilepsy and a chromosomal location involved in the genetic transmission of schizophrenia. An evolutionarily recent partial duplication event in this region results in a hybrid containing sequence from this gene and a novel FAM7A gene. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Protein length : 321 amino acids
Molecular Weight : 61.050kDa inclusive of tags
Source : Wheat germ
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MQEADISGYIPNGEWDLVGIPGKRSERFYECCKEPYPDVT FTVTMRRRTLYYGLSLLIPCVLISALALLVFLLPADSGEK ISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTM ITVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLNWCAW FLRMKRPGEDKVRPACQHKQRRCSLASVEMSAVAPPPASN GNLLYIGFRGLDGVHCVPTPDSGVVCGRMACSPTHDEHLL HGGQPPEGDPDLAKILEEVRYIANRFRCQDESEAVCSEWK FAACVVDRLCLMAFSVFTIICTIGILMSAPNFVEAVSKDF A
Sequence Similarities : Belongs to the ligand-gated ion channel (TC 1.A.9) family. Acetylcholine receptor (TC 1.A.9.1) subfamily. Alpha-7/CHRNA7 sub-subfamily.
Gene Name : CHRNA7 cholinergic receptor, nicotinic, alpha 7 [ Homo sapiens ]
Official Symbol : CHRNA7
Synonyms : CHRNA7; cholinergic receptor, nicotinic, alpha 7; cholinergic receptor, nicotinic, alpha polypeptide 7; neuronal acetylcholine receptor subunit alpha-7;
Gene ID : 1139
mRNA Refseq : NM_000746
Protein Refseq : NP_000737
MIM : 118511
Uniprot ID : P36544
Chromosome Location : 15q13.3
Pathway : Acetylcholine Binding And Downstream Events, organism-specific biosystem; Activation of Nicotinic Acetylcholine Receptors, organism-specific biosystem; Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem; Cholinergic synapse, organism-specific biosystem;
Function : acetylcholine binding; acetylcholine receptor activity; acetylcholine-activated cation-selective channel activity; beta-amyloid binding; chloride channel regulator activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All CHRNA7 Products

Required fields are marked with *

My Review for All CHRNA7 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends