Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human CHRND

Cat.No. : CHRND-26906TH
Product Overview : Recombinant fragment of Human CHRND with N terminal proprietary tag; Predicted MW 37.40 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : The acetylcholine receptor of muscle has 5 subunits of 4 different types: 2 alpha and 1 each of beta, gamma and delta subunits.After acetylcholine binding, the receptor undergoes an extensive conformation change that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.
Protein length : 107 amino acids
Molecular Weight : 37.400kDa inclusive of tags
Source : Wheat germ
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : EEERLIRHLFQEKGYNKELRPVAHKEESVDVALALTLSNL ISLKEVEETLTTNVWIEHGWTDNRLKWNAEEFGNISVLRL PPDMVWLPEIVLENNNDGSFQISYSCN
Sequence Similarities : Belongs to the ligand-gated ion channel (TC 1.A.9) family. Acetylcholine receptor (TC 1.A.9.1) subfamily. Delta/CHRND sub-subfamily.
Gene Name : CHRND cholinergic receptor, nicotinic, delta [ Homo sapiens ]
Official Symbol : CHRND
Synonyms : CHRND; cholinergic receptor, nicotinic, delta; ACHRD, cholinergic receptor, nicotinic, delta polypeptide; acetylcholine receptor subunit delta;
Gene ID : 1144
mRNA Refseq : NM_000751
Protein Refseq : NP_000742
MIM : 100720
Uniprot ID : Q07001
Chromosome Location : 2q33-qter
Pathway : Acetylcholine Binding And Downstream Events, organism-specific biosystem; Activation of Nicotinic Acetylcholine Receptors, organism-specific biosystem; Highly sodium permeable acetylcholine nicotinic receptors, organism-specific biosystem; Neuroactive ligand-receptor interaction, organism-specific biosystem; Neuroactive ligand-receptor interaction, conserved biosystem;
Function : acetylcholine-activated cation-selective channel activity; extracellular ligand-gated ion channel activity; ion channel activity; receptor activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All CHRND Products

Required fields are marked with *

My Review for All CHRND Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends