Recombinant Human CLEC11A
Cat.No. : | CLEC11A-30961TH |
Product Overview : | Highly pure (>98%) recombinant hIL-11 (human Interleukin-11) |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a member of the C-type lectin superfamily. The encoded protein is a secreted sulfated glycoprotein and functions as a growth factor for primitive hematopoietic progenitor cells. An alternative splice variant has been described but its biological nature has not been determined. |
Source : | E. coli |
Tissue specificity : | Expressed in skeletal tissues including bone marrow, chondrocytes, primary ossification center-associated cells, the perichondrium and periosteum. Lower levels of expression were detected in spleen, thymus, appendix and fetal liver. |
Form : | Lyophilised |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGHGARGAEREWEGGWGGAQEEEREREALMLKHLQEALGLPAGRGD ENPAGTVEGKEDWEMEEDQGEEEEEEATPTPSSGPSP SPTPEDIVTYILGRLAGLDAGLHQLHVRLHALDTRVV ELTQGLRQLRNAAGDTRDAVQALQEAQGRAEREHGRL EGCLKGLRLGHKCFLLSRDFEAQPSASPHPLSPDQPN GGTLENCVAQASDDGSWWDHDCQRRLYYVCEFPF |
Sequence Similarities : | Contains 1 C-type lectin domain. |
Gene Name : | CLEC11A C-type lectin domain family 11, member A [ Homo sapiens ] |
Official Symbol : | CLEC11A |
Synonyms : | CLEC11A; C-type lectin domain family 11, member A; SCGF, stem cell growth factor; lymphocyte secreted C type lectin; C-type lectin domain family 11 member A; CLECSF3; LSLCL; P47; |
Gene ID : | 6320 |
mRNA Refseq : | NM_002975 |
Protein Refseq : | NP_002966 |
MIM : | 604713 |
Uniprot ID : | Q9Y240 |
Chromosome Location : | 19q13.3 |
Function : | binding; growth factor activity; sugar binding; |
Products Types
◆ Recombinant Protein | ||
Clec11a-1738M | Recombinant Mouse Clec11a Protein, His (Fc)-Avi-tagged | +Inquiry |
CLEC11A-001H | Recombinant Human CLEC11A Protein, T7-His-TEV-tagged | +Inquiry |
CLEC11A-1095R | Recombinant Rat CLEC11A Protein, His (Fc)-Avi-tagged | +Inquiry |
CLEC11A-1453H | Recombinant Human CLEC11A Protein, GST-tagged | +Inquiry |
Clec11a-1050M | Active Recombinant Mouse Clec11a Protein, His-tagged | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket