Recombinant Human COX6A1
Cat.No. : | COX6A1-27583TH |
Product Overview : | Recombinant full length Human COX6A1 with N terminal proprietary tag; Predicted MW 37.73 kDa. |
- Specification
- Gene Information
- Related Products
Description : | Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in the electron transfer and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes polypeptide 1 (liver isoform) of subunit VIa, and polypeptide 1 is found in all non-muscle tissues. Polypeptide 2 (heart/muscle isoform) of subunit VIa is encoded by a different gene, and is present only in striated muscles. These two polypeptides share 66% amino acid sequence identity. It has been reported that there may be several pseudogenes on chromosomes 1, 6, 7q21, 7q31-32 and 12. However, only one pseudogene (COX6A1P) on chromosome 1p31.1 has been documented. |
Protein length : | 109 amino acids |
Molecular Weight : | 37.730kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MAVVGVSSVSRLLGRSRPQLGRPMSSGAHGEEGSARMWKT LTFFVALPGVAVSMLNVYLKSHHGEHERPEFIAYPHLRIR TKPFPWGDGNHTLFHNPHVNPLPTGYEDE |
Sequence Similarities : | Belongs to the cytochrome c oxidase subunit 6A family. |
Gene Name : | COX6A1 cytochrome c oxidase subunit VIa polypeptide 1 [ Homo sapiens ] |
Official Symbol : | COX6A1 |
Synonyms : | COX6A1; cytochrome c oxidase subunit VIa polypeptide 1; COX6A; cytochrome c oxidase subunit 6A1, mitochondrial; |
Gene ID : | 1337 |
mRNA Refseq : | NM_004373 |
Protein Refseq : | NP_004364 |
MIM : | 602072 |
Uniprot ID : | P12074 |
Chromosome Location : | 12q24 |
Pathway : | Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Cardiac muscle contraction, organism-specific biosystem; Cardiac muscle contraction, conserved biosystem; Cytochrome c oxidase, organism-specific biosystem; |
Function : | cytochrome-c oxidase activity; |
Products Types
◆ Recombinant Protein | ||
Cox6a1-927M | Recombinant Mouse Cox6a1 Protein, MYC/DDK-tagged | +Inquiry |
COX6A1-1753H | Recombinant Human COX6A1 Protein, GST-tagged | +Inquiry |
COX6A1-1915M | Recombinant Mouse COX6A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
COX6A1-4901C | Recombinant Chicken COX6A1 | +Inquiry |
COX6A1-1433Z | Recombinant Zebrafish COX6A1 | +Inquiry |
◆ Lysates | ||
COX6A1-7331HCL | Recombinant Human COX6A1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket