Recombinant Human CPLX1, His-tagged
Cat.No. : | CPLX1-27587TH |
Product Overview : | Recombinant full length Human CPLX1 with N terminal His tag; 154 amino acids with a predicted MWt 17.1 kDa including tag. |
- Specification
- Gene Information
- Related Products
- Download
Description : | Proteins encoded by the complexin/synaphin gene family are cytosolic proteins that function in synaptic vesicle exocytosis.These proteins bind syntaxin, part of the SNAP receptor.The protein product of this gene binds to the SNAP receptor complex and disrupts it, allowing transmitter release. |
Protein length : | 134 amino acids |
Conjugation : | HIS |
Molecular Weight : | 17.100kDa inclusive of tags |
Source : | E. coli |
Tissue specificity : | Nervous system. In hippocampus and cerebellum, expressed mainly by inhibitory neurons. Overexpressed in substantia nigra from patients with Parkinson disease. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 10% Glycerol |
Storage : | Please see Notes section |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMEFVMKQALGGATKDMGKML GGDEEKDPDAAKKEEERQEALRQAEEERKAKYAKMEAERE AVRQGIRDKYGIKKKEEREAEAQAAMEANSEGSLTRPKKA IPPGCGDEVEEEDESILDTVIKYLPGPLQDMLKK |
Sequence Similarities : | Belongs to the complexin/synaphin family. |
Gene Name : | CPLX1 complexin 1 [ Homo sapiens ] |
Official Symbol : | CPLX1 |
Synonyms : | CPLX1; complexin 1; complexin-1; CPX I; |
Gene ID : | 10815 |
mRNA Refseq : | NM_006651 |
Protein Refseq : | NP_006642 |
MIM : | 605032 |
Uniprot ID : | O14810 |
Chromosome Location : | 4p16.3 |
Pathway : | Acetylcholine Neurotransmitter Release Cycle, organism-specific biosystem; Dopamine Neurotransmitter Release Cycle, organism-specific biosystem; GABA synthesis, release, reuptake and degradation, organism-specific biosystem; Glutamate Neurotransmitter Release Cycle, organism-specific biosystem; Neuronal System, organism-specific biosystem; |
Function : | neurotransmitter transporter activity; syntaxin-1 binding; |
Products Types
◆ Recombinant Protein | ||
CPLX1-1223R | Recombinant Rat CPLX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CPLX1-167C | Recombinant Cynomolgus Monkey CPLX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CPLX1-627H | Recombinant Human CPLX1 Protein, His-tagged | +Inquiry |
CPLX1-828R | Recombinant Rhesus Macaque CPLX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CPLX1-1785H | Recombinant Human CPLX1 Protein, GST-tagged | +Inquiry |
◆ Lysates | ||
CPLX1-7313HCL | Recombinant Human CPLX1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All CPLX1 Products
Required fields are marked with *
My Review for All CPLX1 Products
Required fields are marked with *
0
Inquiry Basket