Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human CSE1L

Cat.No. : CSE1L-27953TH
Product Overview : Recombinant full length Human Cellular Apoptosis Susceptibility with N terminal proprietary tag, predicted mwt: 47.52 kDa.
  • Specification
  • Gene Information
  • Related Products
Description : Proteins that carry a nuclear localization signal (NLS) are transported into the nucleus by the importin-alpha/beta heterodimer. Importin-alpha binds the NLS, while importin-beta mediates translocation through the nuclear pore complex. After translocation, RanGTP binds importin-beta and displaces importin-alpha. Importin-alpha must then be returned to the cytoplasm, leaving the NLS protein behind. The protein encoded by this gene binds strongly to NLS-free importin-alpha, and this binding is released in the cytoplasm by the combined action of RANBP1 and RANGAP1. In addition, the encoded protein may play a role both in apoptosis and in cell proliferation.
Protein length : 195 amino acids
Molecular Weight : 47.520kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Highly expressed in proliferating cells.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MELSDANLQTLTEYLKKTLDPDPAIRRPAEKFLESVEGNQ NYPLLLLTLLEKSQDNVIKVCASVTFKNYIKRNWRIVEDE PNKICEADRVAIKANIVHLMLSSPEQIQKQLSDAISIIGR EDFPQKWPDLLTEMVNRFQSGDFHVINGVLRTAHSLFKRY RHEFKSNELWTEIKLVLDAFALPLTNLFKVWNASW
Sequence Similarities : Belongs to the XPO2/CSE1 family.Contains 1 importin N-terminal domain.
Gene Name : CSE1L CSE1 chromosome segregation 1-like (yeast) [ Homo sapiens ]
Official Symbol : CSE1L
Synonyms : CSE1L; CSE1 chromosome segregation 1-like (yeast); chromosome segregation 1 (yeast homolog) like; exportin-2; CAS; CSE1; XPO2;
Gene ID : 1434
mRNA Refseq : NM_001316
Protein Refseq : NP_001307
MIM : 601342
Uniprot ID : P55060
Chromosome Location : 20q13
Pathway : Direct p53 effectors, organism-specific biosystem; p53 pathway, organism-specific biosystem;
Function : importin-alpha export receptor activity; protein binding; protein transporter activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends