Recombinant Human CSNK1E, His-tagged
Cat.No. : | CSNK1E-27871TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 168-416 of Human CK1 epsilon with N terminal His tag. MWt ~31 kDa; |
- Specification
- Gene Information
- Related Products
Description : | The protein encoded by this gene is a serine/threonine protein kinase and a member of the casein kinase I protein family, whose members have been implicated in the control of cytoplasmic and nuclear processes, including DNA replication and repair. The encoded protein is found in the cytoplasm as a monomer and can phosphorylate a variety of proteins, including itself. This protein has been shown to phosphorylate period, a circadian rhythm protein. Two transcript variants encoding the same protein have been found for this gene. |
Conjugation : | HIS |
Source : | E. coli |
Tissue specificity : | Expressed in all tissues examined, including brain, heart, lung, liver, pancreas, kidney, placenta and skeletal muscle. Expressed in monocytes and lymphocytes but not in granulocytes. |
Form : | Lyophilised:Reconstitution with 115 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | (Amino acid sequence (Sequence determined by 5 Sequencing))RENKNLTGTARYASINTHLGIEQSRRDD LESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKM STPIEVLCKGYPSEFSTYLNFCRSLRFDDKPDYSYLRQLF RNLFHRQGFSYDYVFDWNMLKFGAARNPEDVDRERREH EREERMGQLRGSATRALPPGPPTGATANRLRSAAEPVA STPASRIQPAGNTSPRAISRVDRERKVSMRLHRGAPANVS SSDLTGRQEVSRIPASQTSVPFDHLGK |
Sequence Similarities : | Belongs to the protein kinase superfamily. CK1 Ser/Thr protein kinase family. Casein kinase I subfamily.Contains 1 protein kinase domain. |
Gene Name : | CSNK1E casein kinase 1, epsilon [ Homo sapiens ] |
Official Symbol : | CSNK1E |
Synonyms : | CSNK1E; casein kinase 1, epsilon; casein kinase I isoform epsilon; HCKIE; |
Gene ID : | 1454 |
mRNA Refseq : | NM_001894 |
Protein Refseq : | NP_001885 |
MIM : | 600863 |
Uniprot ID : | P49674 |
Chromosome Location : | 22q13.1 |
Pathway : | Canonical Wnt signaling pathway, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem; Centrosome maturation, organism-specific biosystem; Circadian Clock, organism-specific biosystem; Circadian rhythm - mammal, organism-specific biosystem; |
Function : | ATP binding; nucleotide binding; protein binding; protein kinase activity; protein serine/threonine kinase activity; |
Products Types
◆ Recombinant Protein | ||
CSNK1E-885R | Recombinant Rhesus Macaque CSNK1E Protein, His (Fc)-Avi-tagged | +Inquiry |
CSNK1E-0202H | Recombinant Human CSNK1E Protein (E2-K416), Tag Free | +Inquiry |
CSNK1E-1370H | Recombinant Human CSNK1E Protein (1-416 aa), His-tagged | +Inquiry |
CSNK1E-0203H | Recombinant Human CSNK1E Protein (E2-K416), GST tagged | +Inquiry |
CSNK1E-1994H | Active Recombinant Human CSNK1E Protein, GST-tagged | +Inquiry |
◆ Lysates | ||
CSNK1E-7240HCL | Recombinant Human CSNK1E 293 Cell Lysate | +Inquiry |
CSNK1E-7239HCL | Recombinant Human CSNK1E 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket