Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human CST1, His-tagged

Cat.No. : CST1-27161TH
Product Overview : Recombinant full length protein, corresponding to amino acids 21-141 of Human Cystatin SN with N terminal His tag; 145 amino acids, 16.9kDa.
  • Specification
  • Gene Information
  • Related Products
Description : The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions, where they appear to provide protective functions. The cystatin locus on chromosome 20 contains the majority of the type 2 cystatin genes and pseudogenes. This gene is located in the cystatin locus and encodes a cysteine proteinase inhibitor found in saliva, tears, urine, and seminal fluid.
Protein length : 121 amino acids
Conjugation : HIS
Molecular Weight : 16.900kDa inclusive of tags
Source : E. coli
Tissue specificity : Expressed in submandibular and sublingual saliva but not in parotid saliva (at protein level). Expressed in saliva, tears, urine and seminal fluid.
Form : Liquid
Purity : >95% by SDS-PAGE
Storage buffer : pH: 8.00Constituents:10% Glycerol, 0.58% Sodium chloride, 0.32% Tris HCl, 0.03% DTT
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMGSMWSPKEEDRIIPGGIYN ADLNDEWVQRALHFAISEYNKATKDDYYRRPLRVLRARQQ TVGGVNYFFDVEVGRTICTKSQPNLDTCAFHEQPELQKKQ LCSFEIYEVPWENRRSLVKS RCQES
Sequence Similarities : Belongs to the cystatin family.
Gene Name : CST1 cystatin SN [ Homo sapiens ]
Official Symbol : CST1
Synonyms : CST1; cystatin SN; cystatin-SN;
Gene ID : 1469
mRNA Refseq : NM_001898
Protein Refseq : NP_001889
MIM : 123855
Uniprot ID : P01037
Chromosome Location : 20p11.2
Pathway : Salivary secretion, organism-specific biosystem; Salivary secretion, conserved biosystem;
Function : cysteine-type endopeptidase inhibitor activity; peptidase inhibitor activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends