Recombinant Human CTTN, His-tagged
Cat.No. : | CTTN-27962TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 503-593 of Human Cortactin, isoform CRA_a with N terminal His tag; Predicted MWt 10 kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene is overexpressed in breast cancer and squamous cell carcinomas of the head and neck. The encoded protein is localized in the cytoplasm and in areas of the cell-substratum contacts. This gene has two roles: (1) regulating the interactions between components of adherens-type junctions and (2) organizing the cytoskeleton and cell adhesion structures of epithelia and carcinoma cells. During apoptosis, the encoded protein is degraded in a caspase-dependent manner. The aberrant regulation of this gene contributes to tumor cell invasion and metastasis. Three splice variants that encode different isoforms have been identified for this gene. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 38 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | ELAFSCVRVALVPIKCSRDLPGQARGLRSALWRVGRKDCP RRGASSRVSLLGRRGLGLMEVNPELSHPEHRSCHVRWE ICLCHTVTARRIR |
Sequence Similarities : | Contains 7 cortactin repeats.Contains 1 SH3 domain. |
Gene Name : | CTTN cortactin [ Homo sapiens ] |
Official Symbol : | CTTN |
Synonyms : | CTTN; cortactin; EMS1, ems1 sequence (mammary tumor and squamous cell carcinoma associated (p80/85 src substrate); src substrate cortactin; |
Gene ID : | 2017 |
mRNA Refseq : | NM_001184740 |
Protein Refseq : | NP_001171669 |
MIM : | 164765 |
Uniprot ID : | Q14247 |
Chromosome Location : | 11q13 |
Pathway : | Bacterial invasion of epithelial cells, organism-specific biosystem; Bacterial invasion of epithelial cells, conserved biosystem; E-cadherin signaling in the nascent adherens junction, organism-specific biosystem; FGF signaling pathway, organism-specific biosystem; N-cadherin signaling events, organism-specific biosystem; |
Function : | protein binding; |
Products Types
◆ Recombinant Protein | ||
Cttn-432R | Recombinant Rat Cttn Protein, His-tagged | +Inquiry |
Cttn-431M | Recombinant Mouse Cttn Protein, His-tagged | +Inquiry |
CTTN-1330R | Recombinant Rat CTTN Protein, His (Fc)-Avi-tagged | +Inquiry |
CTTN-915R | Recombinant Rhesus Macaque CTTN Protein, His (Fc)-Avi-tagged | +Inquiry |
CTTN-7017C | Recombinant Chicken CTTN | +Inquiry |
◆ Lysates | ||
CTTN-421HCL | Recombinant Human CTTN cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket