Recombinant Human CYP3A5
Cat.No. : | CYP3A5-26690TH |
Product Overview : | Recombinant full length Human Cytochrome P450 3A5 with N terminal proprietary tag; Predicted MWt 80.96 kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene,CYP3A5, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by glucocorticoids and some pharmacological agents. The enzyme metabolizes drugs such as nifedipine and cyclosporine as well as the steroid hormones testosterone, progesterone and androstenedione. This gene is part of a cluster of cytochrome P450 genes on chromosome 7q21.1. This cluster includes a pseudogene, CYP3A5P1, which is very similar to CYP3A5. This similarity has caused some difficulty in determining whether cloned sequences represent the gene or the pseudogene. Multiple alternatively spliced transcript variants have been identified for this gene. |
Protein length : | 502 amino acids |
Molecular Weight : | 80.960kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MDLIPNLAVETWLLLAVSLVLLYLYGTRTHGLFKRLGIPG PTPLPLLGNVLSYRQGLWKFDTECYKKYGKMWGTYEGQLP VLAITDPDVIRTVLVKECYSVFTNRRSLGPVGFMKSAISL AEDEEWKRIRSLLSPTFTSGKLKEMFPIIAQYGDVLVRNL RREAEKGKPVTLKDIFGAYSMDVITGTSFGVNIDSLNNPQ DPFVESTKKFLKFGFLDPLFLSIILFPFLTPVFEALNVSL FPKDTINFLSKSVNRMKKSRLNDKQKHRLDFLQLMIDSQN SKETESHKALSDLELAAQSIIFIFAGYETTSSVLSFTLYE LATHPDVQQKLQKEIDAVLPNKAPPTYDAVVQMEYLDMVV NETLRLFPVAIRLERTCKKDVEINGVFIPKGSMVVIPTYA LHHDPKYWTEPEEFRPERFSKKKDSIDPYIYTPFGTGPRN CIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLDTQG LLQPEKPIVLKVDSRDGTLSGE |
Sequence Similarities : | Belongs to the cytochrome P450 family. |
Gene Name : | CYP3A5 cytochrome P450, family 3, subfamily A, polypeptide 5 [ Homo sapiens ] |
Official Symbol : | CYP3A5 |
Synonyms : | CYP3A5; cytochrome P450, family 3, subfamily A, polypeptide 5; cytochrome P450, subfamily IIIA (niphedipine oxidase), polypeptide 5; cytochrome P450 3A5; CP35; P450PCN3; PCN3; |
Gene ID : | 1577 |
mRNA Refseq : | NM_000777 |
Protein Refseq : | NP_000768 |
MIM : | 605325 |
Uniprot ID : | P20815 |
Chromosome Location : | 7q21.1 |
Pathway : | Biological oxidations, organism-specific biosystem; Cytochrome P450 - arranged by substrate type, organism-specific biosystem; Drug metabolism - cytochrome P450, organism-specific biosystem; Drug metabolism - cytochrome P450, conserved biosystem; Drug metabolism - other enzymes, organism-specific biosystem; |
Function : | aromatase activity; electron carrier activity; heme binding; metal ion binding; monooxygenase activity; |
Products Types
◆ Recombinant Protein | ||
CYP3A5-2276H | Recombinant Human CYP3A5 Protein, GST-tagged | +Inquiry |
CYP3A5-01H | Active Recombinant Human CYP3A5 Protein | +Inquiry |
CYP3A5-129C | Active Recombinant Cynomolgus CYP3A5 Protein | +Inquiry |
CYP3A5-69H | Active Recombinant Human CYP3A5 Protein | +Inquiry |
CYP3A5-82H | Active Recombinant Human CYP3A5 Protein | +Inquiry |
◆ Lysates | ||
CYP3A5-7106HCL | Recombinant Human CYP3A5 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket