Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human DAP

Cat.No. : DAP-27364TH
Product Overview : Recombinant full length Human DAP1 with a N terminal proprietary tag: predicted molecular weight 36.96 kDa, inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : This gene encodes a basic, proline-rich, 15-kD protein. The protein acts as a positive mediator of programmed cell death that is induced by interferon-gamma.
Protein length : 102 amino acids
Molecular Weight : 36.960kDa inclusive of tags
Source : Wheat germ
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MSSPPEGKLETKAGHPPAVKAGGMRIVQKHPHTGDTKEEK DKDDQEWESPSPPKPTVFISGVIARGDKDFPPAAAQVAHQ KPHASMDKHPSPRTQHIQQPRK
Gene Name : DAP death-associated protein [ Homo sapiens ]
Official Symbol : DAP
Synonyms : DAP; death-associated protein; death-associated protein 1;
Gene ID : 1611
mRNA Refseq : NM_004394
Protein Refseq : NP_004385
MIM : 600954
Uniprot ID : P51397
Chromosome Location : 5p15.2
Pathway : TNF-alpha/NF-kB Signaling Pathway, organism-specific biosystem;
Function : death domain binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All DAP Products

Required fields are marked with *

My Review for All DAP Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends