Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human DBH

Cat.No. : DBH-26886TH
Product Overview : Recombinant fragment corresponding to amino acids 494-603 of Human Dopamine beta Hydroxylase with an N terminal proprietary tag: Predicted MWt 37.73 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : The protein encoded by this gene is an oxidoreductase belonging to the copper type II, ascorbate-dependent monooxygenase family. It is present in the synaptic vesicles of postganglionic sympathetic neurons and converts dopamine to norepinephrine. It exists in both soluble and membrane-bound forms, depending on the absence or presence, respectively, of a signal peptide.
Protein length : 110 amino acids
Molecular Weight : 37.730kDa inclusive of tags
Source : Wheat germ
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : DAGFLQKYFHLINRFNNEDVCTCPQASVSQQFTSVPWNSF NRDVLKALYSFAPISMHCNKSSAVRFQGEWNLQPLPKVIS TLEEPTPQCPTSQGRSPAGPTVVSIGGGKG
Sequence Similarities : Belongs to the copper type II ascorbate-dependent monooxygenase family.Contains 1 DOMON domain.
Gene Name : DBH dopamine beta-hydroxylase (dopamine beta-monooxygenase) [ Homo sapiens ]
Official Symbol : DBH
Synonyms : DBH; dopamine beta-hydroxylase (dopamine beta-monooxygenase); dopamine beta-hydroxylase; DBM;
Gene ID : 1621
mRNA Refseq : NM_000787
Protein Refseq : NP_000778
MIM : 609312
Uniprot ID : P09172
Chromosome Location : 9q34
Pathway : Amine-derived hormones, organism-specific biosystem; Biogenic Amine Synthesis, organism-specific biosystem; Catecholamine biosynthesis, organism-specific biosystem; Catecholamine biosynthesis, tyrosine => dopamine =>
Function : L-ascorbic acid binding; catalytic activity; copper ion binding; dopamine beta-monooxygenase activity; metal ion binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All DBH Products

Required fields are marked with *

My Review for All DBH Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends