Recombinant Human DBNL, His-tagged
Cat.No. : | DBNL-29323TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 148-430 of Human HIP55 with an N-terminal His tag; Predicted MWt 33 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 166 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | RFQDVGPQAPVGSVYQKTNAVSEIKRVGKDSFWAKAEKEE ENRRLEEKRRAEEAQRQLEQERRERELREAARREQRYQ EQGGEASPQRTWEQQQEVVSRNRNEQESAVHPREIFKQ KERAMSTTSISSPQPGKLRSPFLQKQLTQPETHFGREP AAAISRPRADLPAEEPAPSTPPCLVQAEEEAVYEEPPEQE TFYEQPPLVQQQGAGSEHIDHHIQGQGLSGQGLCARAL YDYQAADDTEISFDPENLITGIEVIDEGWWRGYGPDGH FGMFPANYVELIE |
Sequence Similarities : | Belongs to the ABP1 family.Contains 1 ADF-H domain.Contains 1 SH3 domain. |
Gene Name : | DBNL drebrin-like [ Homo sapiens ] |
Official Symbol : | DBNL |
Synonyms : | DBNL; drebrin-like; drebrin-like protein; HIP 55; SH3P7; |
Gene ID : | 28988 |
mRNA Refseq : | NM_001014436 |
Protein Refseq : | NP_001014436 |
MIM : | 610106 |
Uniprot ID : | Q9UJU6 |
Chromosome Location : | 7p13 |
Pathway : | Apoptosis, organism-specific biosystem; Apoptotic cleavage of cellular proteins, organism-specific biosystem; Apoptotic executionphase, organism-specific biosystem; Caspase-mediated cleavage of cytoskeletal proteins, organism-specific biosystem; JNK signaling in the CD4+ TCR pathway, organism-specific biosystem; |
Function : | actin binding; enzyme activator activity; protein binding; |
Products Types
◆ Recombinant Protein | ||
DBNL-2211M | Recombinant Mouse DBNL Protein, His (Fc)-Avi-tagged | +Inquiry |
DBNL-1441R | Recombinant Rat DBNL Protein, His (Fc)-Avi-tagged | +Inquiry |
DBNL-2370H | Recombinant Human DBNL Protein, GST-tagged | +Inquiry |
DBNL-978H | Recombinant Human DBNL Protein,DDK-tagged | +Inquiry |
Dbnl-2465M | Recombinant Mouse Dbnl Protein, Myc/DDK-tagged | +Inquiry |
◆ Lysates | ||
DBNL-7063HCL | Recombinant Human DBNL 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All DBNL Products
Required fields are marked with *
My Review for All DBNL Products
Required fields are marked with *
0
Inquiry Basket