Recombinant Human DCAF6, His-tagged
Cat.No. : | DCAF6-27575TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 536-860 of Human NRIP with N terminal His tag; 325 amino acids, 74kDa. |
- Specification
- Gene Information
- Related Products
- Download
Description : | WD-repeat proteins are a large family of eukaryotic proteins coordinating multi-protein complex assemblies. Their role has been implicated in multiple cellular processes including signal transduction, transcriptional regulation, cell cycle control and apoptosis. NRIP is a novel 860a.a nuclear protein consisting of seven conserved WD40 domains and one NLS motif. It binds to androgen and glucocorticoid receptors and up-regulates their transcriptional activity, thereby functioning as a nuclear receptor co-activator. Role of NRIP has been implicated in cell growth and also in cervical and prostrate cancer, thus indicating a potential therapeutic intervention. Northern Blot analysis detects a high expression of NRIP in skeletal muscle and testis and low expression in heart, prostrate and adrenal gland. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 68 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | ETKAPEESSEDVTKYQEGVSAENPVENHINITQSDKFTAK PLDSNSGERNDLNLDRSCGVPEESASSEKAKEPETSDQ TSTESATNENNTNPEPQFQTEATGPSAHEETSTRDSAL QDTDDSDDDPVLIPGARYRAGPGDRRSAVARIQEFFRRRK ERKEMEELDTLNIRRPLVKMVYKGHRNSRTMIKEANFW GANFVMSGSDCGHIFIWDRHTAEHLMLLEADNHVVNCL QPHPFDPILASSGIDYDIKIWSPLEESRIFNRKLADEVIT RNELMLEETRNTITVPASFMLRMLASLNHIRADRLEGD RSEGSGQENENEDEE |
Gene Name : | DCAF6 DDB1 and CUL4 associated factor 6 [ Homo sapiens ] |
Official Symbol : | DCAF6 |
Synonyms : | DCAF6; DDB1 and CUL4 associated factor 6; IQ motif and WD repeats 1 , IQWD1; DDB1- and CUL4-associated factor 6; PC326; |
Gene ID : | 55827 |
mRNA Refseq : | NM_018442 |
Protein Refseq : | NP_060912 |
MIM : | 610494 |
Uniprot ID : | Q58WW2 |
Chromosome Location : | 1q23.3 |
Function : | ligand-dependent nuclear receptor transcription coactivator activity; |
Products Types
◆ Recombinant Protein | ||
DCAF6-5057H | Recombinant Human DCAF6 Protein, GST-tagged | +Inquiry |
DCAF6-2222M | Recombinant Mouse DCAF6 Protein, His (Fc)-Avi-tagged | +Inquiry |
DCAF6-7304Z | Recombinant Zebrafish DCAF6 | +Inquiry |
DCAF6-4338M | Recombinant Mouse DCAF6 Protein | +Inquiry |
◆ Lysates | ||
DCAF6-870HCL | Recombinant Human DCAF6 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All DCAF6 Products
Required fields are marked with *
My Review for All DCAF6 Products
Required fields are marked with *
0
Inquiry Basket