Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human DCTN2, His-tagged

Cat.No. : DCTN2-26061TH
Product Overview : Recombinant fragment, corresponding to amino acids 132-406 of Human Dynamitin with N terminas His tag, 275aa, 35kDa,
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : This gene encodes a 50-kD subunit of dynactin, a macromolecular complex consisting of 10-11 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein. It is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit is present in 4-5 copies per dynactin molecule. It contains three short alpha-helical coiled-coil domains that may mediate association with self or other dynactin subunits. It may interact directly with the largest subunit (p150) of dynactin and may affix p150 in place.
Conjugation : HIS
Source : E. coli
Form : Lyophilised:reconstitution with 52 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : SATEEKLTPVLLAKQLAALKQQLVASHLEKLLGPDAAINL TDPDGALAKRLLLQLEATKNSKGGSGGKTTGTPPDSSL VTYELHSRPEQDKFSQAAKVAELEKRLTELETAVRCDQ DAQNPLSAGLQGACLMETVELLQAKVSALDLAVLDQVEAR LQSVLGKVNEIAKHKASVEDADTQSKVHQLYETIQRWS PIASTLPELVQRLVTIKQLHEQAMQFGQLLTHLDTTQQ MIANSLKDNTTLLTQVQTTMRENLATVEGNFASIDERM KKLGK
Gene Name : DCTN2 dynactin 2 (p50) [ Homo sapiens ]
Official Symbol : DCTN2
Synonyms : DCTN2; dynactin 2 (p50); dynactin subunit 2; DCTN 50; RBP50;
Gene ID : 10540
mRNA Refseq : NM_006400
Protein Refseq : NP_006391
MIM : 607376
Uniprot ID : Q13561
Chromosome Location : 12q13.3
Pathway : Cell Cycle, Mitotic, organism-specific biosystem; Centrosome maturation, organism-specific biosystem; G2/M Transition, organism-specific biosystem; Huntingtons disease, organism-specific biosystem; Huntingtons disease, conserved biosystem;
Function : motor activity; protein binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All DCTN2 Products

Required fields are marked with *

My Review for All DCTN2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends