Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human DDAH2, His-tagged

Cat.No. : DDAH2-26260TH
Product Overview : Recombinant fragment, corresponding to amino acids 71-261 of Human DDAH2 with N terminal His tag; MWt 22kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : This gene belongs to the dimethylarginine dimethylaminohydrolase (DDAH) gene family. The encoded enzyme plays a role in nitric oxide generation by regulating cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity.
Conjugation : HIS
Source : E. coli
Tissue specificity : Detected in heart, placenta, lung, liver, skeletal muscle, kidney and pancreas, and at very low levels in brain.
Form : Lyophilised:Reconstitute with 53 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : LGPLLGDTAVIQGDTALITRPWSPARRPEVDGVRKALQDL GLRIVEIGDENATLDGTDVLFTGREFFVGLSKWTNHRG AEIVADTFRDFAVSTVPVSGPSHLRGLCGMGGPRTVVA GSSDAAQKAVRAMAVLTDHPYASLTLPDDAAADCLFLR PGLPGVPPFLLHRGGGDLPNSQEALQKLSDVTLVPVS
Sequence Similarities : Belongs to the DDAH family.
Gene Name : DDAH2 dimethylarginine dimethylaminohydrolase 2 [ Homo sapiens ]
Official Symbol : DDAH2
Synonyms : DDAH2; dimethylarginine dimethylaminohydrolase 2; N(G),N(G)-dimethylarginine dimethylaminohydrolase 2;
Gene ID : 23564
mRNA Refseq : NM_013974
Protein Refseq : NP_039268
MIM : 604744
Uniprot ID : O95865
Chromosome Location : 6p21
Function : amino acid binding; catalytic activity; dimethylargininase activity; hydrolase activity; protein binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All DDAH2 Products

Required fields are marked with *

My Review for All DDAH2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends