Recombinant Human DECR2, His-tagged
Cat.No. : | DECR2-27085TH |
Product Overview : | Recombinant full length Human DECR2 with N terminal His tag; 315 amino acids with tag, Predicted MWt 33.2 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Description : | Peroxisomal 2,4-dienoyl-CoA reductase is an enzyme that in humans is encoded by the DECR2 gene. |
Protein length : | 292 amino acids |
Conjugation : | HIS |
Molecular Weight : | 33.200kDa inclusive of tags |
Source : | E. coli |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 40% Glycerol, 0.88% Sodium chloride, 0.02% DTT |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMGSMAQPPPDVEGDDCLPAY RHLFCPDLLRDKVAFITGGGSGIGFRIAEIFMRHGCHTVI ASRSLPRVLTAARKLAGATGRRCLPLSMDVRAPPAVMAAV DQALKEFGRIDILINCAAGNFLCPAGALSFNAFKTVMDID TSGTFNVSRVLYEKFFRDHGGVIVNITATLGNRGQALQVH AGSAKAAVDAMTRHLAVEWGPQNIRVNSLAPGPISGTEGL RRLGGPQASLSTKVTASPLQRLGNKTEIAHSVLYLASPLA SYVTGAVLVADGGAWLTFPNGVKGLPDFASFSAKL |
Sequence Similarities : | Belongs to the short-chain dehydrogenases/reductases (SDR) family. 2,4-dienoyl-CoA reductase subfamily. |
Gene Name : | DECR2 2,4-dienoyl CoA reductase 2, peroxisomal [ Homo sapiens ] |
Official Symbol : | DECR2 |
Synonyms : | DECR2; 2,4-dienoyl CoA reductase 2, peroxisomal; peroxisomal 2,4-dienoyl-CoA reductase; PDCR; SDR17C1; short chain dehydrogenase/reductase family 17C; member 1; |
Gene ID : | 26063 |
mRNA Refseq : | NM_020664 |
Protein Refseq : | NP_065715 |
Uniprot ID : | Q9NUI1 |
Chromosome Location : | 16p13.3 |
Pathway : | Peroxisome, organism-specific biosystem; Peroxisome, conserved biosystem; fatty acid beta-oxidation IV (unsaturated, even number), organism-specific biosystem; |
Function : | 2,4-dienoyl-CoA reductase (NADPH) activity; nucleotide binding; oxidoreductase activity; |
Products Types
◆ Recombinant Protein | ||
DECR2-2511H | Recombinant Human DECR2 Protein, GST-tagged | +Inquiry |
DECR2-1049R | Recombinant Rhesus Macaque DECR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
DECR2-1484R | Recombinant Rat DECR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
DECR2-12508Z | Recombinant Zebrafish DECR2 | +Inquiry |
DECR2-1224R | Recombinant Rhesus monkey DECR2 Protein, His-tagged | +Inquiry |
◆ Lysates | ||
DECR2-462HCL | Recombinant Human DECR2 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All DECR2 Products
Required fields are marked with *
My Review for All DECR2 Products
Required fields are marked with *
0
Inquiry Basket