Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human DIXDC1, His-tagged

Cat.No. : DIXDC1-27609TH
Product Overview : Recombinant fragment, corresponding to amino acids 85-258 of Human DIXDC1 with N terminal His tag; 174 amino acids, 20kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : DIXDC1 belongs to the DIXDC1 family and contains 1 CH (calponin homology) domain and 1 DIX domain.The coiled coil domain mediates interaction with MAP3K4 and inhibition of AXIN1 mediated JNK activation through MAP3K4.The DIX domain mediates interaction with AXIN1 and inhibition of AXIN1 mediated JNK activation through MAP3K1. Probably also mediates interaction with DVL2.Functions as a positive effector of the Wnt signaling pathway. Regulates JNK activation by AXIN1 and DVL2.
Conjugation : HIS
Source : E. coli
Form : Lyophilised:Reconstitute with 141 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : VEKVLQFVASKKIRMHQTSAKDIVDGNLKSIMRLVLALAA HFKPGSSRTVNQGRDSRAPLQSHRPHCATAVAQGAAAA LADVCHDMSRSGRDVFRYRQRNSSMDEEIENPYWSVRA LVQQYEGQQRSPSESSCSSLTSPSPIHSAKSESIITQSEE KADFVIIPAEGIENRTEG
Gene Name : DIXDC1 DIX domain containing 1 [ Homo sapiens ]
Official Symbol : DIXDC1
Synonyms : DIXDC1; DIX domain containing 1; dixin; KIAA1735;
Gene ID : 85458
mRNA Refseq : NM_001037954
Protein Refseq : NP_001033043
MIM : 610493
Uniprot ID : Q155Q3
Chromosome Location : 11q23.1
Function : actin binding; gamma-tubulin binding; mitogen-activated protein kinase kinase kinase binding; protein binding; protein domain specific binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All DIXDC1 Products

Required fields are marked with *

My Review for All DIXDC1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends