Recombinant Human DLG4
Cat.No. : | DLG4-31002TH |
Product Overview : | Recombinant fragment corresponding to amino acids 665-766 of Human PSD95 isoform 2 with a N terminal proprietary tag; predicted MWt 36.85 kDa inclusive of tag |
- Specification
- Gene Information
- Related Products
- Download
Description : | This gene encodes a member of the membrane-associated guanylate kinase (MAGUK) family. It heteromultimerizes with another MAGUK protein, DLG2, and is recruited into NMDA receptor and potassium channel clusters. These two MAGUK proteins may interact at postsynaptic sites to form a multimeric scaffold for the clustering of receptors, ion channels, and associated signaling proteins. Multiple transcript variants encoding different isoforms have been found for this gene. |
Protein length : | 102 amino acids |
Molecular Weight : | 36.850kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Brain. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | QGKHCILDVSANAVRRLQAAHLHPIAIFIRPRSLENVLEI NKRITEEQARKAFDRATKLEQEFTECFSAIVEGDSFEEIY HKVKRVIEDLSGPYIWVPARER |
Sequence Similarities : | Belongs to the MAGUK family.Contains 1 guanylate kinase-like domain.Contains 3 PDZ (DHR) domains.Contains 1 SH3 domain. |
Gene Name : | DLG4 discs, large homolog 4 (Drosophila) [ Homo sapiens ] |
Official Symbol : | DLG4 |
Synonyms : | DLG4; discs, large homolog 4 (Drosophila); disks large homolog 4; PSD 95; PSD95; SAP 90; SAP90; |
Gene ID : | 1742 |
mRNA Refseq : | NM_001128827 |
Protein Refseq : | NP_001122299 |
MIM : | 602887 |
Uniprot ID : | P78352 |
Chromosome Location : | 17p13.1 |
Pathway : | Activation of Ca-permeable Kainate Receptor, organism-specific biosystem; Activation of Kainate Receptors upon glutamate binding, organism-specific biosystem; Activation of NMDA receptor upon glutamate binding and postsynaptic events, organism-specific biosystem; Axon guidance, organism-specific biosystem; CREB phosphorylation through the activation of CaMKII, organism-specific biosystem; |
Function : | protein C-terminus binding; protein binding; scaffold protein binding; |
Products Types
◆ Recombinant Protein | ||
Dlg4-2576M | Recombinant Mouse Dlg4 Protein, Myc/DDK-tagged | +Inquiry |
DLG4-1540R | Recombinant Rat DLG4 Protein, His (Fc)-Avi-tagged | +Inquiry |
DLG4-2397M | Recombinant Mouse DLG4 Protein, His (Fc)-Avi-tagged | +Inquiry |
Dlg4-1346M | Recombinant Mouse Dlg4 Protein, His-tagged | +Inquiry |
DLG4-32H | Recombinant Human DLG4 Protein (Mut), N-6×His tagged | +Inquiry |
◆ Lysates | ||
DLG4-6910HCL | Recombinant Human DLG4 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All DLG4 Products
Required fields are marked with *
My Review for All DLG4 Products
Required fields are marked with *
0
Inquiry Basket