Recombinant Human DNAJB11, His-tagged
Cat.No. : | DNAJB11-28367TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 44-358 of Human DNAJB11 with an N terminal His tag. Predicted mwt: 37 kDa; |
- Specification
- Gene Information
- Related Products
- Download
Description : | DNAJB11 belongs to the evolutionarily conserved DNAJ/HSP40 family of proteins, which regulate molecular chaperone activity by stimulating ATPase activity. |
Conjugation : | HIS |
Source : | E. coli |
Tissue specificity : | Widely expressed. |
Form : | Lyophilised:Reconstitute with 107 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | AYRKLALQLHPDRNPDDPQAQEKFQDLGAAYEVLSDSEKR KQYDTYGEEGLKDGHQSSHGDIFSHFFGDFGFMFGGTP RQQDRNIPRGSDIIVDLEVTLEEVYAGNFVEVVRNKPVAR QAPGKRKCNCRQEMRTTQLGPGRFQMTQEVVCDECPNV KLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPG DLRFRIKVVKHPIFERRGDDLYTNVTISLVESLVGFEMDI THLDGHKVHISRDKITRPGAKLWKKGEGLPNFDNNNIK GSLIITFDVDFPKEQLTEEAREGIKQLLKQGSVQKVYN GLQGY |
Sequence Similarities : | Contains 1 J domain. |
Gene Name : | DNAJB11 DnaJ (Hsp40) homolog, subfamily B, member 11 [ Homo sapiens ] |
Official Symbol : | DNAJB11 |
Synonyms : | DNAJB11; DnaJ (Hsp40) homolog, subfamily B, member 11; dnaJ homolog subfamily B member 11; EDJ; ERdj3; HEDJ; |
Gene ID : | 51726 |
mRNA Refseq : | NM_016306 |
Protein Refseq : | NP_057390 |
MIM : | 611341 |
Uniprot ID : | Q9UBS4 |
Chromosome Location : | 3q27 |
Pathway : | Activation of Chaperones by IRE1alpha, organism-specific biosystem; Diabetes pathways, organism-specific biosystem; Protein processing in endoplasmic reticulum, organism-specific biosystem; Protein processing in endoplasmic reticulum, conserved biosystem; Unfolded Protein Response, organism-specific biosystem; |
Function : | heat shock protein binding; unfolded protein binding; |
Products Types
◆ Recombinant Protein | ||
DNAJB11-2731H | Recombinant Human DNAJB11 Protein, GST-tagged | +Inquiry |
DNAJB11-2434M | Recombinant Mouse DNAJB11 Protein, His (Fc)-Avi-tagged | +Inquiry |
Dnajb11-2595M | Recombinant Mouse Dnajb11 Protein, Myc/DDK-tagged | +Inquiry |
DNAJB11-1560R | Recombinant Rat DNAJB11 Protein, His (Fc)-Avi-tagged | +Inquiry |
DNAJB11-28366TH | Recombinant Human DNAJB11, His-tagged | +Inquiry |
◆ Lysates | ||
DNAJB11-6891HCL | Recombinant Human DNAJB11 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All DNAJB11 Products
Required fields are marked with *
My Review for All DNAJB11 Products
Required fields are marked with *
0
Inquiry Basket