Recombinant Human DNAJB8, His-tagged
Cat.No. : | DNAJB8-26156TH |
Product Overview : | Recombinant full-length Human DNAJB8 (amino acids 1-232) with a N terminal His tag; 252 amino acids with a predicted MWt 27.8 kDa including tag. |
- Specification
- Gene Information
- Related Products
- Download
Description : | DNAJB8 belongs to the evolutionarily conserved DNAJ/HSP40 family of proteins, which regulate molecular chaperone activity by stimulating ATPase activity. |
Protein length : | 232 amino acids |
Conjugation : | HIS |
Molecular Weight : | 27.800kDa inclusive of tags |
Source : | E. coli |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 40% Glycerol, 0.88% Sodium chloride, 0.02% DTT |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMANYYEVLGVQASASPEDIK KAYRKLALRWHPDKNPDNKEEAEKKFKLVSEAYEVLSDSK KRSLYDRAGCDSWRAGGGASTPYHSPFDTGYTFRNPEDIF REFFGGLDPFSFEFWDSPFNSDRGGRGHGLRGAFSAGFGE FPAFMEAFSSFNMLGCSGGSHTTFSSTSFGGSSSGSSGFK SVMSSTEMINGHKVTTKRIVENGQERVEVEEDGQLKSVTV NGKEQLKWMDSK |
Sequence Similarities : | Contains 1 J domain. |
Gene Name : | DNAJB8 DnaJ (Hsp40) homolog, subfamily B, member 8 [ Homo sapiens ] |
Official Symbol : | DNAJB8 |
Synonyms : | DNAJB8; DnaJ (Hsp40) homolog, subfamily B, member 8; dnaJ homolog subfamily B member 8; MGC33884; |
Gene ID : | 165721 |
mRNA Refseq : | NM_153330 |
Protein Refseq : | NP_699161 |
MIM : | 611337 |
Uniprot ID : | Q8NHS0 |
Chromosome Location : | 3q21.3 |
Function : | heat shock protein binding; unfolded protein binding; |
Products Types
◆ Recombinant Protein | ||
DNAJB8-2743H | Recombinant Human DNAJB8 Protein, GST-tagged | +Inquiry |
DNAJB8-2443M | Recombinant Mouse DNAJB8 Protein, His (Fc)-Avi-tagged | +Inquiry |
DNAJB8-4694M | Recombinant Mouse DNAJB8 Protein | +Inquiry |
DNAJB8-6898H | Recombinant Human DnaJ (Hsp40) Homolog, Subfamily B, Member 8, His-tagged | +Inquiry |
DNAJB8-12069H | Recombinant Human DNAJB8, His-tagged | +Inquiry |
◆ Lysates | ||
DNAJB8-494HCL | Recombinant Human DNAJB8 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All DNAJB8 Products
Required fields are marked with *
My Review for All DNAJB8 Products
Required fields are marked with *
0
Inquiry Basket