Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human DNMBP, His-tagged

Cat.No. : DNMBP-28369TH
Product Overview : Recombinant fragment, corresponding to amino acids 1400-1577 of Human DNMBP with N terminal His tag; 178 amino acids, 44kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : DNMBP belongs to the DBL (MIM 311030) family of guanine nucleotide exchange factors and plays a role in the regulation of cell junctions (Otani et al.
Conjugation : His
Source : E. coli
Tissue specificity : Detected in heart, brain, lung, liver, skeletal muscle, kidney and pancreas.
Form : Lyophilised:Reconstitute with 84 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : QKQPQDASPPPKECDQGTLSASLNPSNSESSPSRCPSDPD STSQPRSGDSADVARDVKQPTATPRSYRNFRHPEIVGY SVPGRNGQSQDLVKGCARTAQAPEDRSTEPDGSEAEGN QVYFAVYTFKARNPNELSVSANQKLKILEFKDVTGNTEWW LAEVNGKKGYVPSNYIRKTEYT
Sequence Similarities : Contains 1 BAR domain.Contains 1 DH (DBL-homology) domain.Contains 6 SH3 domains.
Gene Name : DNMBP dynamin binding protein [ Homo sapiens ]
Official Symbol : DNMBP
Synonyms : DNMBP; dynamin binding protein; dynamin-binding protein; ARHGEF36; KIAA1010; scaffold protein TUBA; Tuba;
Gene ID : 23268
mRNA Refseq : NM_015221
Protein Refseq : NP_056036
MIM : 611282
Uniprot ID : Q6XZF7
Chromosome Location : 10q24.31
Pathway : Regulation of CDC42 activity, organism-specific biosystem;
Function : Rho guanyl-nucleotide exchange factor activity; guanyl-nucleotide exchange factor activity; protein binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All DNMBP Products

Required fields are marked with *

My Review for All DNMBP Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends