Recombinant Human DNMBP, His-tagged
Cat.No. : | DNMBP-28369TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 1400-1577 of Human DNMBP with N terminal His tag; 178 amino acids, 44kDa. |
- Specification
- Gene Information
- Related Products
- Download
Description : | DNMBP belongs to the DBL (MIM 311030) family of guanine nucleotide exchange factors and plays a role in the regulation of cell junctions (Otani et al. |
Conjugation : | His |
Source : | E. coli |
Tissue specificity : | Detected in heart, brain, lung, liver, skeletal muscle, kidney and pancreas. |
Form : | Lyophilised:Reconstitute with 84 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | QKQPQDASPPPKECDQGTLSASLNPSNSESSPSRCPSDPD STSQPRSGDSADVARDVKQPTATPRSYRNFRHPEIVGY SVPGRNGQSQDLVKGCARTAQAPEDRSTEPDGSEAEGN QVYFAVYTFKARNPNELSVSANQKLKILEFKDVTGNTEWW LAEVNGKKGYVPSNYIRKTEYT |
Sequence Similarities : | Contains 1 BAR domain.Contains 1 DH (DBL-homology) domain.Contains 6 SH3 domains. |
Gene Name : | DNMBP dynamin binding protein [ Homo sapiens ] |
Official Symbol : | DNMBP |
Synonyms : | DNMBP; dynamin binding protein; dynamin-binding protein; ARHGEF36; KIAA1010; scaffold protein TUBA; Tuba; |
Gene ID : | 23268 |
mRNA Refseq : | NM_015221 |
Protein Refseq : | NP_056036 |
MIM : | 611282 |
Uniprot ID : | Q6XZF7 |
Chromosome Location : | 10q24.31 |
Pathway : | Regulation of CDC42 activity, organism-specific biosystem; |
Function : | Rho guanyl-nucleotide exchange factor activity; guanyl-nucleotide exchange factor activity; protein binding; |
Products Types
◆ Recombinant Protein | ||
DNMBP-2472M | Recombinant Mouse DNMBP Protein, His (Fc)-Avi-tagged | +Inquiry |
DNMBP-2788H | Recombinant Human DNMBP Protein, GST-tagged | +Inquiry |
DNMBP-12107H | Recombinant Human DNMBP, GST-tagged | +Inquiry |
DNMBP-0394H | Recombinant Human DNMBP protein, His-tagged | +Inquiry |
DNMBP-4739M | Recombinant Mouse DNMBP Protein | +Inquiry |
◆ Lysates | ||
DNMBP-501HCL | Recombinant Human DNMBP cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All DNMBP Products
Required fields are marked with *
My Review for All DNMBP Products
Required fields are marked with *
0
Inquiry Basket