Recombinant Human DOCK1
Cat.No. : | DOCK1-26153TH |
Product Overview : | Recombinant full length Human DOCK1 with N-terminal proprietary tag, 42.79 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Description : | This gene product binds to the SH3 domain of CRK protein. It may regulate cell surface extension and may have a role in the cell surface extension of an engulfing cell around a dying cell during apoptosis. |
Protein length : | 152 amino acids |
Molecular Weight : | 42.790kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Highly expressed in placenta, lung, kidney, pancreas and ovary. Expressed at intermediate level in thymus, testes and colon. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MRIGRQSCKIHNYAINNGLFFKCMISPPSGDVRNDIYVTL VQGDFDKGSKTTAKNVEVTVSVYDEDGKRLEHVIFPGAGD EAISEYKSVIYYQVKQPRWFETVKVLFTWSFYHMALIMKC SFVTQGNILTSSSARELLQAGRVSPNKVIQGC |
Sequence Similarities : | Belongs to the DOCK family.Contains 1 DHR-1 (CZH-1) domain.Contains 1 DHR-2 (CZH-2) domain.Contains 1 SH3 domain. |
Gene Name : | DOCK1 dedicator of cytokinesis 1 [ Homo sapiens ] |
Official Symbol : | DOCK1 |
Synonyms : | DOCK1; dedicator of cytokinesis 1; dedicator of cyto kinesis 1; dedicator of cytokinesis protein 1; ced5; DOCK180; DOwnstream of CrK; |
Gene ID : | 1793 |
mRNA Refseq : | NM_001380 |
Protein Refseq : | NP_001371 |
MIM : | 601403 |
Uniprot ID : | Q14185 |
Chromosome Location : | 10q26.13-q26.3 |
Pathway : | Axon guidance, organism-specific biosystem; Bacterial invasion of epithelial cells, organism-specific biosystem; Bacterial invasion of epithelial cells, conserved biosystem; DCC mediated attractive signaling, organism-specific biosystem; Developmental Biology, organism-specific biosystem; |
Function : | GTP binding; GTPase activator activity; GTPase binding; SH3 domain binding; guanyl-nucleotide exchange factor activity; |
Products Types
◆ Recombinant Protein | ||
DOCK1-2802H | Recombinant Human DOCK1 Protein, GST-tagged | +Inquiry |
DOCK1-401H | Recombinant Human DOCK1 Protein, His-tagged | +Inquiry |
DOCK1-6085Z | Recombinant Zebrafish DOCK1 | +Inquiry |
DOCK1-2543H | Recombinant Human DOCK1 protein, His-tagged | +Inquiry |
DOCK1-1980H | Recombinant Human DOCK1 Protein (Arg443-Cys627), N-His tagged | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All DOCK1 Products
Required fields are marked with *
My Review for All DOCK1 Products
Required fields are marked with *
0
Inquiry Basket