Recombinant Human DOCK7, His-tagged
Cat.No. : | DOCK7-28082TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 1823-2109 of Human DOCK7 with a N terminal His tag; predicted MWt 35 kDa: |
- Specification
- Gene Information
- Related Products
- Download
Description : | DOCK7 functions as a guanine nucleotide exchange factor (GEF), which activates Rac1 and Rac3 Rho small GTPases by exchanging bound GDP for free GTP. It does not have a GEF activity for CDC42. It is required for STMN1 Ser-15 phosphorylation during axon formation and consequently for neuronal polarization. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:reconstitution with 69 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | DLDEQEFVYKEPAITKLAEISHRLEGFYGERFGEDVVEVI KDSNPVDKCKLDPNKAYIQITYVEPYFDTYEMKDRITY FDKNYNLRRFMYCTPFTLDGRAHGELHEQFKRKTILTT SHAFPYIKTRVNVTHKEEIILTPIEVAIEDMQKKTQELAF ATHQDPADPKMLQMVLQGSVGTTVNQGPLEVAQVFLSE IPSDPKLFRHHNKLRLCFKDFTKRCEDALRKNKSLIGP DQKEYQRELERNYHRLKEALQPLINRKIPQLYKAVLPV TCHRDSFSRMSLRKMDL |
Gene Name : | DOCK7 dedicator of cytokinesis 7 [ Homo sapiens ] |
Official Symbol : | DOCK7 |
Synonyms : | DOCK7; dedicator of cytokinesis 7; dedicator of cytokinesis protein 7; KIAA1771; ZIR2; |
Gene ID : | 85440 |
mRNA Refseq : | NM_033407 |
Protein Refseq : | NP_212132 |
Uniprot ID : | Q96N67 |
Chromosome Location : | 1p32.1 |
Pathway : | ErbB2/ErbB3 signaling events, organism-specific biosystem; Factors involved in megakaryocyte development and platelet production, organism-specific biosystem; Hemostasis, organism-specific biosystem; |
Function : | GTP binding; GTPase binding; Rac GTPase binding; guanyl-nucleotide exchange factor activity; |
Products Types
◆ Recombinant Protein | ||
DOCK7-2808H | Recombinant Human DOCK7 Protein, GST-tagged | +Inquiry |
DOCK7-1370H | Recombinant Human DOCK7 Protein, His-tagged | +Inquiry |
Dock7-1371R | Recombinant Rat Dock7 Protein, His-tagged | +Inquiry |
◆ Lysates | ||
DOCK7-504HCL | Recombinant Human DOCK7 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All DOCK7 Products
Required fields are marked with *
My Review for All DOCK7 Products
Required fields are marked with *
0
Inquiry Basket