Recombinant Human DSTN, His-tagged
Cat.No. : | DSTN-26582TH |
Product Overview : | Recombinant full length protein, corresponding to amino acids 1-165 of Human Destrin with an N terminal His tag. Predicted MWt: 20 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Description : | The product of this gene belongs to the actin-binding proteins ADF family. This family of proteins is responsible for enhancing the turnover rate of actin in vivo. This gene encodes the actin depolymerizing protein that severs actin filaments (F-actin) and binds to actin monomers (G-actin). Two transcript variants encoding distinct isoforms have been identified for this gene. |
Conjugation : | HIS |
Source : | E. coli |
Tissue specificity : | Widely distributed in various tissues. |
Form : | Lyophilised:Reconstitute with 102 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MASGVQVADEVCRIFYDMKVRKCSTPEEIKKRKKAVIFCL SADKKCIIVEEGKEILVGDVGVTITDPFKHFVGMLPEK DCRYALYDASFETKESRKEELMFFLWAPELAPLKSKMI YASSKDAIKKKFQGIKHECQANGPEDLNRACIAEKLGG SLIVAFEGCPV |
Sequence Similarities : | Belongs to the actin-binding proteins ADF family.Contains 1 ADF-H domain. |
Gene Name : | DSTN destrin (actin depolymerizing factor) [ Homo sapiens ] |
Official Symbol : | DSTN |
Synonyms : | DSTN; destrin (actin depolymerizing factor); destrin; ACTDP; ADF; |
Gene ID : | 11034 |
mRNA Refseq : | NM_006870 |
Protein Refseq : | NP_006861 |
MIM : | 609114 |
Uniprot ID : | P60981 |
Chromosome Location : | 20p12.1 |
Function : | actin binding; |
Products Types
◆ Recombinant Protein | ||
Dstn-2665M | Recombinant Mouse Dstn Protein, Myc/DDK-tagged | +Inquiry |
DSTN-1162R | Recombinant Rhesus Macaque DSTN Protein, His (Fc)-Avi-tagged | +Inquiry |
DSTN-1622R | Recombinant Rat DSTN Protein, His (Fc)-Avi-tagged | +Inquiry |
DSTN-2894H | Recombinant Human DSTN Protein, GST-tagged | +Inquiry |
DSTN-30180H | Recombinant Human DSTN protein, GST-tagged | +Inquiry |
◆ Lysates | ||
DSTN-6805HCL | Recombinant Human DSTN 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All DSTN Products
Required fields are marked with *
My Review for All DSTN Products
Required fields are marked with *
0
Inquiry Basket