Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human DSTN, His-tagged

Cat.No. : DSTN-26582TH
Product Overview : Recombinant full length protein, corresponding to amino acids 1-165 of Human Destrin with an N terminal His tag. Predicted MWt: 20 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : The product of this gene belongs to the actin-binding proteins ADF family. This family of proteins is responsible for enhancing the turnover rate of actin in vivo. This gene encodes the actin depolymerizing protein that severs actin filaments (F-actin) and binds to actin monomers (G-actin). Two transcript variants encoding distinct isoforms have been identified for this gene.
Conjugation : HIS
Source : E. coli
Tissue specificity : Widely distributed in various tissues.
Form : Lyophilised:Reconstitute with 102 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MASGVQVADEVCRIFYDMKVRKCSTPEEIKKRKKAVIFCL SADKKCIIVEEGKEILVGDVGVTITDPFKHFVGMLPEK DCRYALYDASFETKESRKEELMFFLWAPELAPLKSKMI YASSKDAIKKKFQGIKHECQANGPEDLNRACIAEKLGG SLIVAFEGCPV
Sequence Similarities : Belongs to the actin-binding proteins ADF family.Contains 1 ADF-H domain.
Gene Name : DSTN destrin (actin depolymerizing factor) [ Homo sapiens ]
Official Symbol : DSTN
Synonyms : DSTN; destrin (actin depolymerizing factor); destrin; ACTDP; ADF;
Gene ID : 11034
mRNA Refseq : NM_006870
Protein Refseq : NP_006861
MIM : 609114
Uniprot ID : P60981
Chromosome Location : 20p12.1
Function : actin binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All DSTN Products

Required fields are marked with *

My Review for All DSTN Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends