Recombinant Human DUSP26, His-tagged
Cat.No. : | DUSP26-26910TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 29-211 of Human DUSP26 with N terminal His tag; 183 amino acids, 21kDa. |
- Specification
- Gene Information
- Related Products
Conjugation : | HIS |
Source : | E. coli |
Tissue specificity : | Brain. In the brain it is expressed ubiquitously except in the hippocampus. Expressed in embryonal cancers (retinoblastoma, neuroepithilioma and neuroblastoma) and in anaplatic thyroid cancer. |
Form : | Lyophilised:Reconstitute with 144 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | RGTLEEMPTVQHPFLNVFELERLLYTGKTACNHADEVWPG LYLGDQDMANNRRELRRLGITHVLNASHSRWRGTPEAY EGLGIRYLGVEAHDSPAFDMSIHFQTAADFIHRALSQP GGKILVHCAVGVSRSATLVLAYLMLYHHLTLVEAIKKVKD HRGIIPNRGFLRQLLALDRRLRQGLEA |
Sequence Similarities : | Belongs to the protein-tyrosine phosphatase family. Non-receptor class dual specificity subfamily.Contains 1 tyrosine-protein phosphatase domain. |
Gene Name : | DUSP26 dual specificity phosphatase 26 (putative) [ Homo sapiens ] |
Official Symbol : | DUSP26 |
Synonyms : | DUSP26; dual specificity phosphatase 26 (putative); dual specificity protein phosphatase 26; DUSP24; MGC1136; |
Gene ID : | 78986 |
mRNA Refseq : | NM_024025 |
Protein Refseq : | NP_076930 |
Uniprot ID : | Q9BV47 |
Chromosome Location : | 8p12 |
Function : | hydrolase activity; protein binding; protein tyrosine phosphatase activity; protein tyrosine/serine/threonine phosphatase activity; |
Products Types
◆ Recombinant Protein | ||
DUSP26-2937H | Recombinant Human DUSP26 Protein, GST-tagged | +Inquiry |
DUSP26-1634R | Recombinant Rat DUSP26 Protein, His (Fc)-Avi-tagged | +Inquiry |
DUSP26-1179R | Recombinant Rhesus Macaque DUSP26 Protein, His (Fc)-Avi-tagged | +Inquiry |
DUSP26-219C | Recombinant Cynomolgus Monkey DUSP26 Protein, His (Fc)-Avi-tagged | +Inquiry |
DUSP26-2569M | Recombinant Mouse DUSP26 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Lysates | ||
DUSP26-6775HCL | Recombinant Human DUSP26 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket