Recombinant Human DUSP7 protein, His-tagged
Cat.No. : | DUSP7-2812H |
Product Overview : | Recombinant Human DUSP7 protein(60-102 aa), fused to His tag, was expressed in E. coli. |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Source : | E. coli |
Species : | Human |
Tag : | His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
Protein length : | 60-102 aa |
AA Sequence : | IRSIIPNHADKERFATRCKAATVLLYDEATAEWQPEPGAPASV |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name : | DUSP7 dual specificity phosphatase 7 [ Homo sapiens ] |
Official Symbol : | DUSP7 |
Synonyms : | DUSP7; dual specificity phosphatase 7; dual specificity protein phosphatase 7; MKP X; PYST2; dual-specificity phosphatase-7; dual specificity protein phosphatase PYST2; MKPX; DKFZp586F2224; |
Gene ID : | 1849 |
mRNA Refseq : | NM_001947 |
Protein Refseq : | NP_001938 |
MIM : | 602749 |
UniProt ID : | Q16829 |
Products Types
◆ Recombinant Protein | ||
DUSP7-2946H | Recombinant Human DUSP7 Protein, GST-tagged | +Inquiry |
DUSP7-10163Z | Recombinant Zebrafish DUSP7 | +Inquiry |
◆ Lysates | ||
DUSP7-516HCL | Recombinant Human DUSP7 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All DUSP7 Products
Required fields are marked with *
My Review for All DUSP7 Products
Required fields are marked with *
0
Inquiry Basket