Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human EGF protein(981-1020 aa), N-MBP & C-His-tagged

Cat.No. : EGF-2509H
Product Overview : Recombinant Human EGF protein(P01133)(981-1020 aa), fused with N-terminal MBP tag and C-terminal His tag, was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
Source : HEK293
Species : Human
Tag : N-MBP & C-His
Protein length : 981-1020 aa
Form : 0.15 M Phosphate buffered saline
AASequence : DGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWW
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
Gene Name : EGF epidermal growth factor [ Homo sapiens ]
Official Symbol : EGF
Synonyms : EGF; epidermal growth factor; epidermal growth factor (beta urogastrone); pro-epidermal growth factor; beta-urogastrone; URG; HOMG4;
Gene ID : 1950
mRNA Refseq : NM_001178130
Protein Refseq : NP_001171601
MIM : 131530
UniProt ID : P01133

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends