Recombinant Human EGF protein(981-1020 aa), N-MBP & C-His-tagged
Cat.No. : | EGF-2509H |
Product Overview : | Recombinant Human EGF protein(P01133)(981-1020 aa), fused with N-terminal MBP tag and C-terminal His tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
Source : | HEK293 |
Species : | Human |
Tag : | N-MBP & C-His |
Protein length : | 981-1020 aa |
Form : | 0.15 M Phosphate buffered saline |
AASequence : | DGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWW |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name : | EGF epidermal growth factor [ Homo sapiens ] |
Official Symbol : | EGF |
Synonyms : | EGF; epidermal growth factor; epidermal growth factor (beta urogastrone); pro-epidermal growth factor; beta-urogastrone; URG; HOMG4; |
Gene ID : | 1950 |
mRNA Refseq : | NM_001178130 |
Protein Refseq : | NP_001171601 |
MIM : | 131530 |
UniProt ID : | P01133 |
Products Types
◆ Native Protein | ||
Egf-634M | Active Native Mouse Egf | +Inquiry |
EGF-23H | Active Native Human EGF protein | +Inquiry |
Egf-635R | Native Rat Egf | +Inquiry |
◆ Lysates | ||
EGF-2716HCL | Recombinant Human EGF cell lysate | +Inquiry |
EGF-973MCL | Recombinant Mouse EGF cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket