Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human EIF3D, His-tagged

Cat.No. : EIF3D-26387TH
Product Overview : Recombinant fragment, corresponding to amino acids 148-330 of Human EIF3D with an N terminal His tag; Predicted MWt 22 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : Eukaryotic translation initiation factor-3 (eIF3), the largest of the eIFs, is a multiprotein complex composed of at least ten nonidentical subunits. The complex binds to the 40S ribosome and helps maintain the 40S and 60S ribosomal subunits in a dissociated state. It is also thought to play a role in the formation of the 40S initiation complex by interacting with the ternary complex of eIF2/GTP/methionyl-tRNA, and by promoting mRNA binding. The protein encoded by this gene is the major RNA binding subunit of the eIF3 complex.
Conjugation : HIS
Source : E. coli
Form : Lyophilised:Reconstitute with 84 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : QKWDQKSQKPRDSSVEVRSDWEVKEEMDFPQLMKMRYLEV SEPQDIECCGALEYYDKAFDRITTRSEKPLRSIKRIFH TVTTTDDPVIRKLAKTQGNVFATDAILATLMSCTRSVY SWDIVVQRVGSKLFFDKRDNSDFDLLTVSETANEPPQD EGNSFNSPRNLAMEATYINHNFSQQCLRM
Sequence Similarities : Belongs to the eIF-3 subunit D family.
Gene Name : EIF3D eukaryotic translation initiation factor 3, subunit D [ Homo sapiens ]
Official Symbol : EIF3D
Synonyms : EIF3D; eukaryotic translation initiation factor 3, subunit D; EIF3S7, eukaryotic translation initiation factor 3, subunit 7 zeta, 66/67kDa; eukaryotic translation initiation factor 3 subunit D; eIF3 p66; eIF3 zeta; eIF3d;
Gene ID : 8664
mRNA Refseq : NM_003753
Protein Refseq : NP_003744
MIM : 603915
Uniprot ID : O15371
Chromosome Location : 22q13.1
Pathway : Activation of the mRNA upon binding of the cap-binding complex and eIFs, and subsequent binding to 43S, organism-specific biosystem; Cap-dependent Translation Initiation, organism-specific biosystem; Eukaryotic Translation Initiation, organism-specific biosystem; Formation of a pool of free 40S subunits, organism-specific biosystem; Formation of the ternary complex, and subsequently, the 43S complex, organism-specific biosystem;
Function : protein binding; contributes_to translation initiation factor activity; contributes_to translation initiation factor activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All EIF3D Products

Required fields are marked with *

My Review for All EIF3D Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends