Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human EIF3K, His-tagged

Cat.No. : EIF3K-27408TH
Product Overview : Recombinant fragment: VLKLYQFNPA FFQTTVTAQI LLKALTNLPH TDFTLCKCMI DQAHQ, corresponding to amino acids 50-94 of Human eIF3K fused to a His tag at N-terminal end, 10kDa.
  • Specification
  • Gene Information
  • Related Products
Description : The 700-kD eukaryotic translation initiation factor-3 (eIF3) is the largest eIF and contains at least 12 subunits, including EIF2S12. eIF3 plays an essential role in translation by binding directly to the 40S ribosomal subunit and promoting formation of the 40S preinitiation complex (Mayeur et al.
Conjugation : HIS
Source : E. coli
Tissue specificity : Ubiquitous, with the highest levels of expression in brain, testis and kidney.
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: PBS
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Sequences of amino acids : VLKLYQFNPAFFQTTVTAQILLKALTNLPHTDFTLCKCMIDQAHQ
Sequence Similarities : Belongs to the eIF-3 subunit K family.
Gene Name : EIF3K eukaryotic translation initiation factor 3, subunit K [ Homo sapiens ]
Official Symbol : EIF3K
Synonyms : EIF3K; eukaryotic translation initiation factor 3, subunit K; EIF3S12, eukaryotic translation initiation factor 3, subunit 12; eukaryotic translation initiation factor 3 subunit K; ARG134; eIF3k; HSPC029; M9; PLAC 24; PRO1474; PTD001;
Gene ID : 27335
mRNA Refseq : NM_013234
Protein Refseq : NP_037366
MIM : 609596
Uniprot ID : Q9UBQ5
Chromosome Location : 19q13.2
Pathway : Activation of the mRNA upon binding of the cap-binding complex and eIFs, and subsequent binding to 43S, organism-specific biosystem; Cap-dependent Translation Initiation, organism-specific biosystem; Eukaryotic Translation Initiation, organism-specific biosystem; Formation of a pool of free 40S subunits, organism-specific biosystem; Formation of the ternary complex, and subsequently, the 43S complex, organism-specific biosystem;
Function : binding; ribosome binding; contributes_to translation initiation factor activity; contributes_to translation initiation factor activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends