Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human EIF4G1 protein, Myc/DDK-tagged

Cat.No. : EIF4G1-02H
Product Overview : Recombinant Human EIF4G1 protein, fused to Myc/DDK-tagged, was expressed in HEK293T. Protein Pathways: Viral myocarditis.
  • Specification
  • Gene Information
  • Related Products
Description : The protein encoded by this gene is a component of the multi-subunit protein complex EIF4F. This complex facilitates the recruitment of mRNA to the ribosome, which is a rate-limiting step during the initiation phase of protein synthesis. The recognition of the mRNA cap and the ATP-dependent unwinding of 5'-terminal secondary structure is catalyzed by factors in this complex. The subunit encoded by this gene is a large scaffolding protein that contains binding sites for other members of the EIF4F complex. A domain at its N-terminus can also interact with the poly(A)-binding protein, which may mediate the circularization of mRNA during translation. Alternative splicing results in multiple transcript variants, some of which are derived from alternative promoter usage.
Source : HEK293T
Species : Human
Tag : Myc/DDK
Form : 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 175.3 kDa
AA Sequence : myc-FLAG tag
Product-Related Proteins : TA50011-100
LC404962
TA351152
RC219841
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Usage : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL
Gene Name : EIF4G1 eukaryotic translation initiation factor 4 gamma 1 [ Homo sapiens (human) ]
Official Symbol : EIF4G1
Synonyms : EIF-4G1; EIF4F; EIF4G; EIF4GI; P220; PARK18
Gene ID : 1981
mRNA Refseq : NM_198241
Protein Refseq : NP_937884
MIM : 600495
UniProt ID : Q96I65

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends