Recombinant Human ENO3
Cat.No. : | ENO3-28566TH |
Product Overview : | Recombinant full length Human ENO3 with N terminal proprietary tag; Predicted MWt 73.48 kDa, inclusive of tag. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes one of the three enolase isoenzymes found in mammals. This isoenzyme is found in skeletal muscle cells in the adult where it may play a role in muscle development and regeneration. A switch from alpha enolase to beta enolase occurs in muscle tissue during development in rodents. Mutations in this gene have be associated glycogen storage disease. Alternatively spliced transcript variants encoding different isoforms have been described. |
Protein length : | 434 amino acids |
Molecular Weight : | 73.480kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | The alpha/alpha homodimer is expressed in embryo and in most adult tissues. The alpha/beta heterodimer and the beta/beta homodimer are found in striated muscle, and the alpha/gamma heterodimer and the gamma/gamma homodimer in neurons. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MAMQKIFAREILDSRGNPTVEVDLHTAKGRFRAAVPSGAS TGIYEALELRDGDKGRYLGKGVLKAVENINSTLGPALLQK KLSVADQEKVDKFMIELDGTENKSKFGANAILGVSLAVCK AGAAEKGVPLYRHIADLAGNPDLILPVPAFNVINGGSHAG NKLAMQEFMILPVGASSFKEAMRIGAEVYHHLKGVIKAKY GKDATNVGDEGGFAPNILENNEALELLKTAIQAAGYPDKV VIGMDVAASEFYRNGKYDLDFKSPDDPARHITGEKLGELY KSFIKNYPVVSIEDPFDQDDWATWTSFLSGVNIQIVGDDL TVTNPKRIAQAVEKKACNCLLLKVNQIGSVTESIQACKLA QSNGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCR SERLAKYNQLMRIEEALGDKAIFAGRKFRNPKAK |
Sequence Similarities : | Belongs to the enolase family. |
Gene Name : | ENO3 enolase 3 (beta, muscle) [ Homo sapiens ] |
Official Symbol : | ENO3 |
Synonyms : | ENO3; enolase 3 (beta, muscle); enolase 3, (beta, muscle); beta-enolase; |
Gene ID : | 2027 |
mRNA Refseq : | NM_001193503 |
Protein Refseq : | NP_001180432 |
MIM : | 131370 |
Uniprot ID : | P13929 |
Chromosome Location : | 17pter-p11 |
Pathway : | Gluconeogenesis, organism-specific biosystem; Gluconeogenesis, oxaloacetate => fructose-6P, organism-specific biosystem; Gluconeogenesis, oxaloacetate => fructose-6P, conserved biosystem; |
Function : | lyase activity; magnesium ion binding; phosphopyruvate hydratase activity; protein heterodimerization activity; protein homodimerization activity; |
Products Types
◆ Recombinant Protein | ||
ENO3-1757R | Recombinant Rat ENO3 Protein, His (Fc)-Avi-tagged | +Inquiry |
ENO3-218H | Recombinant Human ENO3 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
ENO3-3316H | Recombinant Human ENO3 Protein, GST-tagged | +Inquiry |
ENO3-2793M | Recombinant Mouse ENO3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Eno3-948M | Recombinant Mouse Eno3 Protein, MYC/DDK-tagged | +Inquiry |
◆ Lysates | ||
ENO3-248HCL | Recombinant Human ENO3 lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket