Recombinant Human ERCC2, His-tagged
Cat.No. : | ERCC2-30131TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 533-760 of Human XPD with an N terminal His tag. Predicted MWt: 27 kDa, |
- Specification
- Gene Information
- Related Products
Description : | The nucleotide excision repair pathway is a mechanism to repair damage to DNA. The protein encoded by this gene is involved in transcription-coupled nucleotide excision repair and is an integral member of the basal transcription factor BTF2/TFIIH complex. The gene product has ATP-dependent DNA helicase activity and belongs to the RAD3/XPD subfamily of helicases. Defects in this gene can result in three different disorders, the cancer-prone syndrome xeroderma pigmentosum complementation group D, trichothiodystrophy, and Cockayne syndrome. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 137 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | DGIVAFFTSYQYMESTVASWYEQGILENIQRNKLLFIETQ DGAETSVALEKYQEACENGRGAILLSVARGKVSEGIDF VHHYGRAVIMFGVPYVYTQSRILKARLEYLRDQFQIRE NDFLTFDAMRHAAQCVGRAIRGKTDYGLMVFADKRFARGD KRGKLPRWIQEHLTDANLNLTVDEGVQVAKYFLRQMAQ PFHREDQLGLSLLSLEQLESEETLKRIEQIAQQL |
Gene Name : | ERCC2 excision repair cross-complementing rodent repair deficiency, complementation group 2 [ Homo sapiens ] |
Official Symbol : | ERCC2 |
Synonyms : | ERCC2; excision repair cross-complementing rodent repair deficiency, complementation group 2; xeroderma pigmentosum complementary group D , XPD; TFIIH basal transcription factor complex helicase XPD subunit; EM9; excision repair cross complementing rodent |
Gene ID : | 2068 |
mRNA Refseq : | NM_000400 |
Protein Refseq : | NP_000391 |
MIM : | 126340 |
Uniprot ID : | P18074 |
Chromosome Location : | 19q13.3 |
Pathway : | Basal transcription factors, organism-specific biosystem; Basal transcription factors, conserved biosystem; DNA Repair, organism-specific biosystem; Dual incision reaction in GG-NER, organism-specific biosystem; Dual incision reaction in TC-NER, organism-specific biosystem; |
Function : | 5-3 DNA helicase activity; ATP binding; ATP-dependent DNA helicase activity; DNA binding; contributes_to DNA-dependent ATPase activity; |
Products Types
◆ Recombinant Protein | ||
ERCC2-2842M | Recombinant Mouse ERCC2 Protein, His (Fc)-Avi-tagged | +Inquiry |
ERCC2-3457H | Recombinant Human ERCC2 Protein, GST-tagged | +Inquiry |
ERCC2-13H | Recombinant Human ERCC2 Protein | +Inquiry |
ERCC2-5285M | Recombinant Mouse ERCC2 Protein | +Inquiry |
ERCC2-2397H | Recombinant Human ERCC2 Protein (Ala404-Leu637), N-His tagged | +Inquiry |
◆ Lysates | ||
ERCC2-6566HCL | Recombinant Human ERCC2 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket