Recombinant Human ETFA, His-tagged
Cat.No. : | ETFA-28858TH |
Product Overview : | Recombinant full length protein, corresponding to amino acids 1-284 of Human MADD with N terminal His Tag; Predicted MWt 31 kDa. |
- Specification
- Gene Information
- Related Products
Description : | ETFA participates in catalyzing the initial step of the mitochondrial fatty acid beta-oxidation. It shuttles electrons between primary flavoprotein dehydrogenases and the membrane-bound electron transfer flavoprotein ubiquinone oxidoreductase. Defects in electron-transfer-flavoprotein have been implicated in type II glutaricaciduria in which multiple acyl-CoA dehydrogenase deficiencies result in large excretion of glutaric, lactic, ethylmalonic, butyric, isobutyric, 2-methyl-butyric, and isovaleric acids. Two transcript variants encoding different isoforms have been found for this gene. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 88 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MFRAAAPGQLRRAVAQDLCKVAGIAKVLVAQHDVYKGLLP EELTPLILATQKQFNYTHICAGASAFGKNLLPRVAAKL EVAPISDIIAIKSPDTFVRTIYAGNALCTVKCDEKVKV FSVRGTSFDAAATSGGSASSEKASSTSPVEISEWLDQKLT KSDRPELTGAKVVVSGGRGLKSGENFKLLYDLADQLHA AVGASRAAVDAGFVPNDMQVGQTGKIVAPELYIAVGIS GAIQHLAGMKDSKTIVAINKDPEAPIFQVADYGIVADL FKVVPEMTEILKKK |
Sequence Similarities : | Belongs to the ETF alpha-subunit/fixB family. |
Gene Name : | ETFA electron-transfer-flavoprotein, alpha polypeptide [ Homo sapiens ] |
Official Symbol : | ETFA |
Synonyms : | ETFA; electron-transfer-flavoprotein, alpha polypeptide; electron transfer flavoprotein subunit alpha, mitochondrial; EMA; GA2; glutaric aciduria II; MADD; |
Gene ID : | 2108 |
mRNA Refseq : | NM_000126 |
Protein Refseq : | NP_000117 |
MIM : | 608053 |
Uniprot ID : | P13804 |
Chromosome Location : | 15q23-q25 |
Pathway : | Metabolism, organism-specific biosystem; Respiratory electron transport, organism-specific biosystem; Respiratory electron transport, ATP synthesis by chemiosmotic coupling, and heat production by uncoupling proteins., organism-specific biosystem; The citric acid (TCA) cycle and respiratory electron transport, organism-specific biosystem; |
Function : | electron carrier activity; flavin adenine dinucleotide binding; oxidoreductase activity; |
Products Types
◆ Recombinant Protein | ||
ETFA-3516H | Recombinant Human ETFA Protein, GST-tagged | +Inquiry |
ETFA-243C | Recombinant Cynomolgus Monkey ETFA Protein, His (Fc)-Avi-tagged | +Inquiry |
ETFA-1816R | Recombinant Rat ETFA Protein, His (Fc)-Avi-tagged | +Inquiry |
ETFA-1334R | Recombinant Rhesus Macaque ETFA Protein, His (Fc)-Avi-tagged | +Inquiry |
ETFA-1509R | Recombinant Rhesus monkey ETFA Protein, His-tagged | +Inquiry |
◆ Lysates | ||
ETFA-6532HCL | Recombinant Human ETFA 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket