Recombinant Human EXOSC5, His-tagged
Cat.No. : | EXOSC5-28337TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 6-235 of Human EXOSC5 with an N terminal His tag. MW 29 kDa; |
- Specification
- Gene Information
- Related Products
- Download
Description : | Exosome component 5, also known as EXOSC5, is a human gene, which is part of the exosome complex. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 96 μl distilled water. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | HTDAKIRAENGTGSSPRGPGCSLRHFACEQNLLSRPDGSA SFLQGDTSVLAGVYGPAEVKVSKEIFNKATLEVILRPK IGLPGVAEKSRERLIRNTCEAVVLGTLHPRTSITVVLQ VVSDAGSLLACCLNAACMALVDAGVPMRALFCGVACALDS DGTLVLDPTSKQEKEARAVLTFALDSVERKLLMSSTKG LYSDTELQQCLAAAQAASQHVFRFYRESLQRRYSKS |
Gene Name : | EXOSC5 exosome component 5 [ Homo sapiens ] |
Official Symbol : | EXOSC5 |
Synonyms : | EXOSC5; exosome component 5; exosome complex component RRP46; exosome component Rrp46; hRrp46p; MGC12901; p12B; RRP41B; RRP46; Rrp46p; |
Gene ID : | 56915 |
mRNA Refseq : | NM_020158 |
Protein Refseq : | NP_064543 |
MIM : | 606492 |
Uniprot ID : | Q9NQT4 |
Chromosome Location : | 19q13.1 |
Pathway : | Deadenylation-dependent mRNA decay, organism-specific biosystem; Destabilization of mRNA by Butyrate Response Factor 1 (BRF1), organism-specific biosystem; Destabilization of mRNA by KSRP, organism-specific biosystem; Destabilization of mRNA by Tristetraprolin (TTP), organism-specific biosystem; Exosome, eukaryotes, organism-specific biosystem; |
Function : | 3-5-exoribonuclease activity; RNA binding; NOT exoribonuclease activity; protein binding; |
Products Types
◆ Recombinant Protein | ||
EXOSC5-0726H | Recombinant Human EXOSC5 Protein (M1-S235), His/Strep tagged | +Inquiry |
EXOSC5-3575H | Recombinant Human EXOSC5 Protein, GST-tagged | +Inquiry |
EXOSC5-2903M | Recombinant Mouse EXOSC5 Protein, His (Fc)-Avi-tagged | +Inquiry |
Exosc5-2892M | Recombinant Mouse Exosc5 Protein, Myc/DDK-tagged | +Inquiry |
EXOSC5-0725H | Recombinant Human EXOSC5 Protein (M1-S235), Tag Free | +Inquiry |
◆ Lysates | ||
EXOSC5-6500HCL | Recombinant Human EXOSC5 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All EXOSC5 Products
Required fields are marked with *
My Review for All EXOSC5 Products
Required fields are marked with *
0
Inquiry Basket